Monoclonal Anti-PROS1 antibody produced in mouse

This gene encodes a vitamin K-dependent plasma protein that functions as a cofactor for the anticoagulant protease, activated protein C (APC) to inhibit blood coagulation. It is found in plasma in both a free, functionally active form and also in an inactive form complexed with C4b-binding protein. Mutations in this gene result in autosomal dominant hereditary thrombophilia. An inactive pseudogene of this locus is located at an adjacent region on chromosome 3. (provided by RefSeq)

PROS1 (NP_000304, 419 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GLLETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRP

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services