Monoclonal Anti-CHN1 antibody produced in mouse

The gene chimerin 1 (CHN1) is mapped to human chromosome 2q31.1. It is mainly expressed in the brain. The gene encodes two splice variants, α1 and α2.

This gene encodes GTPase-activating protein for p21-rac and a phorbol ester receptor. It plays an important role in ocular motor axon pathfinding. Heterozygous missense mutations in this gene cause Duane′s retraction syndrome 2 (DURS2). Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

CHN1 (AAH11393, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTINPIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIP

Chimerin 1 (CHN1) works as a GTPase-activating protein (GAP) for Rac1 (Ras-related C3 botulinum toxin substrate 1). The α1-chimaerin controls dendritic spine growth, branching and morphology. Mutations in this gene are associated with Duane′s retraction syndrome (DRS).

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services