Anti-MECR antibody produced in rabbit

MECR (Mitochondrial trans-2-enoyl-CoA reductase) is a mitochondrial localized protein, also referred to as nuclear receptor binding factor-1 (NRBF-1). It consists of N-terminal mitochondrial targeting sequence, which plays an essential role for its mitochondrial localization. It was firstly identified as a binding protein of the nuclear hormone receptor peroxisome proliferator-activated receptor (PPARα).

MECR (NP_057095.2, 1 a.a. ~ 373 a.a) full-length human protein.

Sequence
MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

MECR (Mitochondrial trans-2-enoyl-CoA reductase) plays a vital role in the intracellular signaling pathways of fatty acid elongation cycle pathway. In the nuclei, it catalyzes reduction reaction of trans-2-enoyl thioesters to the corresponding saturated acyl thioesters in the presence of NADPH. It has also been reported that MECR acts as a component of the mitochondrial FAS II (fatty acid synthesis II) pathway and enhances the PPARa-dependent luciferase activity in HeLa cells.

Solution in phosphate buffered saline, pH 7.4