Monoclonal Anti-PCAF antibody produced in mouse

CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation. (provided by RefSeq)

PCAF (NP_003875, 731 a.a. ~ 832 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK

Solution in phosphate buffered saline, pH 7.4