Monoclonal Anti-RXRG, (N-terminal) antibody produced in mouse

This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)

RXRG (-, 1 a.a. ~ 33 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MYGNYSHFMKFPAGYGGCSSPALQLLLSTSLG

Clear solution