Monoclonal Anti-RPTOR, (C-terminal) antibody produced in mouse

This gene encodes a component of a signaling pathway that regulates cell growth in response to nutrient and insulin levels. The encoded protein forms a stoichiometric complex with the mTOR kinase, and also associates with eukaryotic initiation factor 4E-binding protein-1 and ribosomal protein S6 kinase. The protein positively regulates the downstream effector ribosomal protein S6 kinase, and negatively regulates the mTOR kinase. Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

RPTOR (NP_065812.1, 1226 a.a. ~ 1335 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR

Solution in phosphate buffered saline, pH 7.4