WH0055507M1
Monoclonal Anti-GPRC5D antibody produced in mouse
clone 6D9, purified immunoglobulin, buffered aqueous solution
Sign Into View Organizational & Contract Pricing
All Photos(3)
Anti-G protein-coupled receptor, family C, group 5, member D
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
6D9, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2bκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GPRC5D(55507)
General description
G protein-coupled receptor 5D (GPRC5D), a surface receptor consists of seven putative transmembrane segments. It is expressed in the cell membrane. This protein belongs to the retinoic acid inducible gene 1 or retinoic acid inducible GPCR 1 (RAIG1) family. GPRC5D is located on human chromosome 12p13.
Immunogen
GPRC5D (NP_061124, 261 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV
Sequence
ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV
Biochem/physiol Actions
G protein-coupled receptor 5D (GPRC5D) considered as an important marker for monitoring the tumor load and also to target multiple myeloma cells. Overexpression of GPRC5D affects the expression of hard keratins and also decrease the metabolic activities of hair bulb cells (HBCs).
Features and Benefits
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
nwg
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
The RAIG family member, GPRC5D, is associated with hard-keratinized structures
The Journal of Investigative Dermatology, 122(3), 565-573 (2004)
GPRC5D is a promising marker for monitoring the tumor load and to target multiple myeloma cells
Hematology, 18(6), 348-351 (2013)
Cloning and characterization of a human orphan family C G-protein coupled receptor GPRC5D
Biochimica et Biophysica Acta (BBA)-Gene Structure and Expression, 1518(3), 237-248 (2001)
Overexpression of G protein-coupled receptor 5D in the bone marrow is associated with poor prognosis in patients with multiple myeloma
European Journal of Clinical Investigation, 42(9), 953-960 (2012)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service