WH0007461M7
Monoclonal Anti-CYLN2 antibody produced in mouse
clone 3H5, purified immunoglobulin, buffered aqueous solution
Sign Into View Organizational & Contract Pricing
All Photos(2)
Synonym(s):
Anti-CLIP, Anti-CLIP115, Anti-CLIP2, Anti-KIAA0291, Anti-MGC11333, Anti-WBSCR4, Anti-WSCR4, Anti-cytoplasmic linker 2
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
3H5, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CLIP2(7461)
General description
Cytoplasmic linker protein-115 (CYLN2), also known as CAP-Gly domain containing linker protein 2 (CLIP2), possesses a structural maintenance of chromosomes (Smc) domain. The gene encoding this protein is localized on human chromosome 7q11.23.
Immunogen
CLIP2 (NP_003379, 946 a.a. ~ 1046 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LKDDIRGLREKLTGLDKEKSLSDQRRYSLIDRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH
Sequence
LKDDIRGLREKLTGLDKEKSLSDQRRYSLIDRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH
Biochem/physiol Actions
Cytoplasmic linker protein-115 (CYLN2) or CLIP2 takes part in cell division, segregation of chromosomes and in attaching organelles to microtubules. It may be useful as a marker in papillary thyroid carcinoma (PTC). Mutations in the gene encoding CYLN2 have been associated with Williams-Beuren syndrome and the protein has been shown to be expressed in colorectal carcinomas.
Features and Benefits
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Gain of chromosome band 7q11 in papillary thyroid carcinomas of young patients is associated with exposure to low-dose irradiation.
Julia Hess
Proceedings of the National Academy of Sciences of the USA (2011)
Dose-dependent expression of CLIP2 in post-Chernobyl papillary thyroid carcinomas
Carcinogenesis, 36(36) (2015)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service