biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2B3, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ATF4(468)
Related Categories
General description
Activating transcription factor 4 (ATF4), is a stress-induced transcription factor, encoded by the gene mapped to human chromosome 22q13.1. ATF4 is a member of ATF/CREB (cyclic AMP response element binding protein) family of basic region-leucine zipper (bZip) transcription factors.
This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromsome at q28 in a region containing a large inverted duplication. (provided by RefSeq)
Immunogen
ATF4 (NP_001666.2, 171 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVA
Sequence
SSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVA
Application
Monoclonal Anti-ATF4 antibody produced in mouse has been used in immunocytochemistry and western blotting.
Biochem/physiol Actions
Activating transcription factor 4 (ATF4) induces cAMP-dependent renal cyst formation. It is implicated in the regulation of genes involved in various cellular processes such as oxidative stress, amino acid synthesis, differentiation, metastasis and angiogenesis. Elevated expression of ATF4 has been observed in cancer patients.
Features and Benefits
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Rapid induction of p62 and GABARAPL1 upon proteasome inhibition promotes survival before autophagy activation
Sha Z, et al.
The Journal of cell biology, 217(5), 1757-1776 (2018)
Ultrastructural features of aberrant glial cells isolated from the spinal cord of paralytic rats expressing the amyotrophic lateral sclerosis-linked SOD1G93A mutation
Jimenez-Riani, M, et al.
Cell and Tissue Research, 370(3), 391-401 (2017)
Disrupted autophagy after spinal cord injury is associated with ER stress and neuronal cell death
Liu S, et al.
Cell Death & Disease, 6(1), e1582-e1582 (2015)
Surviving stress: modulation of ATF4-mediated stress responses in normal and malignant cells
Wortel LMN, et al.
Trends in Endocrinology and Metabolism, 28(11), 794-806 (2017)
The centrosomal protein nephrocystin-6 is mutated in Joubert syndrome and activates transcription factor ATF4
Sayer JA, et al.
Nature Genetics, 38(6), 674-681 (2006)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service