SAB1404658
Monoclonal Anti-SOCS3 antibody produced in mouse
clone 2E5, purified immunoglobulin, buffered aqueous solution
Sign Into View Organizational & Contract Pricing
All Photos(1)
ATOD4, CIS3, Cish3, MGC71791, SOCS-3, SSI-3, SSI3
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2E5, monoclonal
form
buffered aqueous solution
mol wt
antigen ~50.86 kDa
species reactivity
human
technique(s)
capture ELISA: suitable
indirect ELISA: suitable
isotype
IgG2aκ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SOCS3(9021)
General description
Suppressor of cytokine signaling 3 (SOCS3) is encoded by the gene mapped to human chromosome 17q25.3.The encoded protein belongs to the SOCS protein family.
Immunogen
SOCS3 (AAH60858, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Biochem/physiol Actions
Suppressor of cytokine signaling 3 (SOCS3) plays a vital role in cytokine signaling. The encoded protein has an ability to bind and inhibit janus kinases (JAKs), turning off signal transducers and activators of transcription 3 (STAT3) signaling in response to interferon (IFN)-6 stimulation. Downregulated expression of the gene enhance the growth and metastasis of colorectal cancer (CRC). Thus, targeting IL-6/STAT3/SOCS3 signaling pathway can be considered as a potent therapeutic strategy for CRC.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Epigenetic alterations associated with cholangiocarcinoma
Oncology Reports, 22(2), 227-232 (2009)
The Suppressor of Cytokine Signaling (SOCS) 1 and SOCS3 but Not SOCS2 Proteins Inhibit Interferon-mediated Antiviral and Antiproliferative Activities
The Journal of Biological Chemistry, 273(52), 35056-35062 (1998)
Prognostic significance of SOCS3 and its biological function in colorectal cancer.
Gene, 627, 114-122 (2017)
Epigenetic Alterations in Cholangiocarcinoma-Sustained IL-6/STAT3 Signaling in Cholangio- carcinoma due to SOCS3 Epigenetic Silencing
Digestion, 79(1), 2-8 (2009)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service