Skip to Content
Merck
CN

AV34608

Anti-EGLN1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Egl nine homolog 1 (C. elegans)

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

NACRES:
NA.41
UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Anti-EGLN1 antibody produced in rabbit, IgG fraction of antiserum

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

46 kDa

species reactivity

guinea pig, rabbit, dog, bovine, horse, human, rat, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... EGLN1(54583)

Application

Rabbit Anti-EGLN1 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

Biochem/physiol Actions

EGLN1 has a role in the regulation of hypoxia-inducible factor. It is not affected by overexpression or downregulation of HIF-2alpha.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

EGL-9 family hypoxia-inducible factor 1 (EGLN1) is a protein that catalyzes 4-hydroxyproline formation in hypoxia-inducible factor (HIF) alpha proteins. Studies have reported that EGLN1 reacts with nitric oxide and modulates hypoxic responses. EGLN1 polymorphisms have been linked to high altitude sickness.
Rabbit Anti-EGLN1 antibody recognizes canine, human, mouse, rat, and zebrafish EGLN1.

Immunogen

Synthetic peptide directed towards the C terminal region of human EGLN1

Other Notes

Synthetic peptide located within the following region: QPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Rasheduzzaman Chowdhury et al.
Journal of molecular biology, 410(2), 268-279 (2011-05-24)
The hypoxic response in animals is mediated via the transcription factor hypoxia-inducible factor (HIF). An oxygen-sensing component of the HIF system is provided by Fe(II) and 2-oxoglutarate-dependent oxygenases that catalyse the posttranslational hydroxylation of the HIF-α subunit. It is proposed
Norman E Buroker et al.
Blood cells, molecules & diseases, 49(2), 67-73 (2012-05-19)
High altitude sickness (HAS) occurs among humans visiting or inhabiting high altitude environments. Genetic differences in the EPAS1 and EGLN1 genes have been found between lowland (Han) and highland (Tibetan) Chinese. Three SNPs within EPAS1 and EGLN1 were evaluated in
Shilpi Aggarwal et al.
Proceedings of the National Academy of Sciences of the United States of America, 107(44), 18961-18966 (2010-10-20)
It is being realized that identification of subgroups within normal controls corresponding to contrasting disease susceptibility is likely to lead to more effective predictive marker discovery. We have previously used the Ayurvedic concept of Prakriti, which relates to phenotypic differences

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service