Skip to Content
Merck
CN
All Photos(1)

Key Documents

Safety Information

AV32342

Sigma-Aldrich

Anti-PSMD4 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Proteasome (prosome, macropain) 26S subunit, non-ATPase, 4

Sign Into View Organizational & Contract Pricing
All Photos(1)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

41 kDa

species reactivity

horse, bovine, human, mouse, sheep, rabbit, dog, rat, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

NP_002801

UniProt accession no.

P55036

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... PSMD4(5710)

General description

PSDM4 is the non-ATPase subunit of the proteasomal 19S regulatory complex that is involved in proteasome-substrate identification. Porcine fertilization studies have reported that PSMD4 regulates sperm-zona pellucida (ZP) penetration. Furthermore, pharmacogenomic analyses have revealed that high expression of PSDM4 is linked to adverse clinical outcomes in myeloma patients undergoing bortezomib treatment.
Rabbit Anti-PSMD4 (AB1) antibody recognizes canine, human, mouse, rat, pig, bovine, chicken, and rabbit PSMD4.

Immunogen

Synthetic peptide directed towards the N terminal region of human PSMD4

Application

Rabbit Anti-PSMD4 (AB2) antibody can be used for western blot applications at a concentration of 0.3μg/ml.

Biochem/physiol Actions

PSMD4 encodes one of the non-ATPase subunits of the 19S regulator lid which is part of a multicatalytic proteinase complex of the 26S proteasome.

Sequence

Synthetic peptide located within the following region: VAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDII

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
QC1804

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

John D Shaughnessy et al.
Blood, 118(13), 3512-3524 (2011-06-02)
Gene expression profiling (GEP) of purified plasma cells 48 hours after thalidomide and dexamethasone test doses showed these agents' mechanisms of action and provided prognostic information for untreated myeloma patients on Total Therapy 2 (TT2). Bortezomib was added in Total
Young-Joo Yi et al.
Cell and tissue research, 341(2), 325-340 (2010-06-08)
Proteolysis of ubiquitinated sperm and oocyte proteins by the 26S proteasome is necessary for the success of mammalian fertilization, including but not limited to acrosomal exocytosis and sperm-zona pellucida (ZP) penetration. The present study examined the role of PSMD4, an
Kihyun Pyun et al.
Pharmacology, biochemistry, and behavior, 124, 278-283 (2014-07-06)
Primary headache disorders, including migraine, are thought to be mediated by prolonged nociceptive activation of the trigeminal nucleus caudalis (TNC), but the precise mechanisms are poorly understood. Our past studies demonstrated that sigma-1 receptors (Sig-1R) facilitate spinal nociceptive transmission in

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service