WH0084444M1
Monoclonal Anti-DOT1L antibody produced in mouse
clone 6A6, purified immunoglobulin, buffered aqueous solution
Sign Into View Organizational & Contract Pricing
All Photos(4)
Anti-DOT1, Anti-DOT1-like, histone H3 methyltransferase (S. cerevisiae), Anti-KIAA1814
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
6A6, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG1κ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... DOT1L(84444)
General description
Disruptor of telomeric silencing 1 (DOT1) like histone lysine methyltransferase (DOT1L) is encoded by the gene mapped to human chromosome 19p13.3.
Immunogen
DOT1L (NP_115871, 3 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLR
Sequence
EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLR
Biochem/physiol Actions
Disruptor of telomeric silencing 1 (DOT1) like histone lysine methyltransferase (DOT1L), is a nucleosomal enzyme that catalyzes the intra-nucleosomal methylation of H3 at lysine-79, a crucial step involved in the regulation of cell cycle, transcriptional regulation, and DNA damage response. Mammalian DOT1 gene plays an essential role in embryogenesis, hematopoiesis, cardiac function, and development of leukemia. Thus, DOT1L can act as a potential target for therapeutic treatment of the same. Elevated DOT1L enzymatic activity leads to MLL (mixed-lineage leukemia). Therefore, inhibition of DOT1L by SYC-522 in combination with DNA-damaging chemotherapy is considered as a potential treatment for MLL.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
nwg
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Genes & development, 25(13), 1345-1358 (2011-07-05)
DOT1 (disruptor of telomeric silencing; also called Kmt4) was initially discovered in budding yeast in a genetic screen for genes whose deletion confers defects in telomeric silencing. Since the discovery ∼10 years ago that Dot1 and its mammalian homolog, DOT1L
PloS one, 9(5), e98270-e98270 (2014-05-27)
DOT1L, the only known histone H3-lysine 79 (H3K79) methyltransferase, has been shown to be essential for the survival and proliferation of mixed-linkage leukemia (MLL) gene rearranged leukemia cells, which are often resistant to conventional chemotherapeutic agents. To study the functions
European journal of human genetics : EJHG, 23(3), 374-380 (2014-06-12)
Despite considerable progress in preventive and therapeutic strategies, myocardial infarction (MI) is one of the leading causes of death throughout the world. A total of 55 susceptibility genes have been identified mostly in European genome-wide association studies (GWAS). Nevertheless, large-scale
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service