WH0064093M3
Monoclonal Anti-SMOC1 antibody produced in mouse
clone 8F10, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-SPARC related modular calcium binding 1
Sign Into View Organizational & Contract Pricing
All Photos(5)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
8F10, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SMOC1(64093)
General description
SPARC related modular calcium binding 1 (SMOC1) is an extracellular glycoprotein belonging to the SPARC family. It is localized and secreted in bone marrow derived mesenchymal stem cells (BMSCs) stimulated with osteogenic medium (OSM). The protein is expressed in the developing optic stalk, ventral optic cup, and limbs of mouse embryos. It is composed of five domains, an N-terminal follistatin-like (FS) domain, two thyroglobulin-like (TY) domains similar to SMOC, and an extracellular calcium-binding (EC) domain.
Immunogen
SMOC1 (NP_071420, 150 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNS
Sequence
SVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNS
Biochem/physiol Actions
SMOC1 plays an essential role in ocular and limb development. It participates in the regulation of cell-matrix interaction by binding to many cell-surface receptors, the extracellular matrix, growth factors, and cytokines. It also functions in bone morphogenetic proteins (BMP) signaling cascade. Mutation in SMOC1 causes a rare autosomal-recessive disorder, microphthalmia and limb anomalies (MLA).
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
nwg
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Ippei Okada et al.
American journal of human genetics, 88(1), 30-41 (2011-01-05)
Microphthalmia with limb anomalies (MLA) is a rare autosomal-recessive disorder, presenting with anophthalmia or microphthalmia and hand and/or foot malformation. We mapped the MLA locus to 14q24 and successfully identified three homozygous (one nonsense and two splice site) mutations in
Young-Ae Choi et al.
Journal of proteome research, 9(6), 2946-2956 (2010-04-03)
Extracellular matrix proteins have been implicated in the regulation of osteoblast differentiation of bone marrow derived mesenchymal stem cells (BMSCs) through paracrine or autocrine mechanisms. In the current study, we analyzed the secretory protein profiles of BMSCs grown in osteogenic
Hana Abouzeid et al.
American journal of human genetics, 88(1), 92-98 (2011-01-05)
Waardenburg anophthalmia syndrome, also known as microphthalmia with limb anomalies, ophthalmoacromelic syndrome, and anophthalmia-syndactyly, is a rare autosomal-recessive developmental disorder that has been mapped to 10p11.23. Here we show that this disease is heterogeneous by reporting on a consanguineous family, not
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service