WH0023327M4
Monoclonal Anti-NEDD4L antibody produced in mouse
clone 1D2, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-KIAA0439, Anti-RSP5, Anti-hNedd42, Anti-neural precursor cell expressed, developmentally down-regulated 4-like
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
1D2, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... NEDD4L(23327)
Related Categories
General description
The gene NEDD4L (neural precursor cell expressed, developmentally down-regulated 4-like) is mapped to human chromosome 18q21. The protein localizes in the cytoplasm.
Immunogen
NEDD4L (AAH32597, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLT
Sequence
MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLT
Biochem/physiol Actions
NEDD4L (neural precursor cell expressed, developmentally down-regulated 4-like) is an ubiquitin ligase which is responsible for the ubiquitination and degradation of proteins. It causes ubiquitination of the TGF (transforming growth factor)-β membrane receptor, activated Smad (mothers against decapentaplegic homolog)-2/3 and inhibitory Smad7. NEDD4L-mediated ubiquitination of kidney epithelial sodium channels (ENaC) subunits plays an important role in hypertension control.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Ran Zhao et al.
Nucleic acids research, 43(16), 7838-7849 (2015-07-02)
The expression of DNA damage-binding protein 2 (DDB2) has been linked to the prognosis of ovarian cancer and its underlying transcription regulatory function was proposed to contribute to the favorable treatment outcome. By applying gene microarray analysis, we discovered neural
Fredrick J Rosario et al.
Clinical science (London, England : 1979), 130(7), 499-512 (2015-11-27)
Changes in placental amino acid transfer directly contribute to altered fetal growth, which increases the risk for perinatal complications and predisposes for the development of obesity, diabetes and cardiovascular disease later in life. Placental amino acid transfer is critically dependent
Go Kuratomi et al.
The Biochemical journal, 386(Pt 3), 461-470 (2004-10-22)
Inhibitory Smad, Smad7, is a potent inhibitor of TGF-beta (transforming growth factor-beta) superfamily signalling. By binding to activated type I receptors, it prevents the activation of R-Smads (receptor-regulated Smads). To identify new components of the Smad pathway, we performed yeast
Albert Escobedo et al.
Structure (London, England : 1993), 22(10), 1446-1457 (2014-10-09)
We investigated the mechanisms of activation and degradation of the E3 ubiquitin ligase Nedd4L combining the available biochemical information with complementary biophysical techniques. Using nuclear magnetic resonance spectroscopy, we identified that the C2 domain binds Ca(2+) and inositol 1,4,5-trisphosphate (IP3) using
H Chen et al.
European journal of human genetics : EJHG, 9(12), 922-930 (2002-02-13)
The validation of full-length cDNA represents a crucial step in gene identification and subsequent functional analysis. In searching for candidate genes for bipolar disorder on chromosome 18q21, a novel gene homologous to NEDD4 (Neural precursor cells expressed developmentally down-regulated) was
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service