WH0007442M1
Monoclonal Anti-TRPV1 antibody produced in mouse
clone 1F5, purified immunoglobulin, buffered aqueous solution
Sign Into View Organizational & Contract Pricing
All Photos(2)
Synonym(s):
Trpv1 Antibody, Trpv1 Antibody - Monoclonal Anti-TRPV1 antibody produced in mouse, Anti-DKFZp434K0220, Anti-VR1, Anti-transient receptor potential cation channel, subfamily V, member 1
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
1F5, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG1κ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... TRPV1(7442)
General description
The gene encoding transient receptor potential cation channel subfamily V member 1 (TRPV1) is mapped to human chromosome 17p13. It is a non-selective cation channel. The protein is expressed on airway nerve fibers. It is also strongly expressed in sensory neurons.
Immunogen
TRPV1 (NP_542437, 21 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ
Sequence
CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ
Biochem/physiol Actions
Transient receptor potential cation channel subfamily V member 1 (TRPV1) is a capsaicin receptor. It participates in pain perception. TRPV1 also modulates afferent signals and bronchoconstriction. In the brain, it regulates neuronal function, motor behaviour and neuroinflammation. Capsaicin plays an important role in the activation of TRPV1.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
TRPV1 on astrocytes rescues nigral dopamine neurons in Parkinson's disease via CNTF.
Nam JH
Brain (2015)
Role of transient receptor potential vanilloid 1 in the modulation of airway smooth muscle tone and calcium handling.
Yocum GT
American Journal of Physiology. Lung Cellular and Molecular Physiology (2017)
The 57 kb deletion in cystinosis patients extends into TRPV1 causing dysregulation of transcription in peripheral blood mononuclear cells.
Freed KA
Journal of medical Genetics (2011)
Gitit Kra et al.
Animals : an open access journal from MDPI, 12(6) (2022-03-26)
Environmental heat load (HL) adversely affects the performance of dairy cows. The endocannabinoid system (ECS) regulates metabolism and the stress response, thus we hypothesized that HL may affect the ECS of dairy cows. Our objective was to determine the levels
J R Daddam et al.
Journal of dairy science (2023-08-29)
We examined the effects of a supplement of plant polyphenols extracts of green tea, capsicum and fenugreek, and electrolytes [(Na+, K+), AXT; Axion ThermoPlus, CCPA, France] during summer heat load on production, welfare, and oxidative stress proteins in adipose tissue
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service