WH0004583M2
Monoclonal Anti-MUC2 antibody produced in mouse
clone 1D10, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-MLP, Anti-mucin 2, intestinal/tracheal
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
Recommended Products
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
1D10, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MUC2(4583)
General description
The MUC2 (mucin 2, oligomeric mucus/gel-forming) protein belongs to the mucin protein family. It is an important mucin released in the large intestine. It is approximately a 550 kDa protein that has two PTS-domains, rich in proline, serine, and threonine. MUC2 is located on human chromosome 11p15.
This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. (provided by RefSeq)
Immunogen
MUC2 (NP_002448, 5081 a.a. ~ 5179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRARRSPRHLGSG*
Sequence
TTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRARRSPRHLGSG*
Biochem/physiol Actions
Mucin 2, oligomeric mucus/gel-forming (MUC2) modulates the expression and antimicrobial activity of β-defensin 2. It acts as a major constituent of the two-layered mucous structure in the colon. Deficiency of MUC2 might lead to opportunistic microbial invasion and/or impaired innate responses.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
12 - Non Combustible Liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
新产品
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Colonic MUC2 mucin regulates the expression and antimicrobial activity of ?-defensin 2
Cobo ER, et al.
Mucosal Immunology, 8(6), 1360-1372 (2015)
Transcriptional regulation of the 11p15 mucin genes. Towards new biological tools in human therapy, in inflammatory diseases and cancer
Van Seuningen I, et al.
Frontiers in Bioscience (2001)
Pooled Resequencing of 122 Ulcerative Colitis Genes in a Large Dutch Cohort Suggests Population-Specific Associations of Rare Variants in MUC2
Visschedijk MC, et al.
PLoS ONE (2016)
Sjoerd van der Post et al.
Journal of proteome research, 13(12), 6013-6023 (2014-11-19)
The polymeric mucin MUC2 constitutes the main structural component of the mucus that covers the colon epithelium. The protein's central mucin domain is highly O-glycosylated and binds water to provide lubrication and prevent dehydration, binds bacteria, and separates the bacteria
Christian V Recktenwald et al.
The Journal of biological chemistry, 291(26), 13580-13590 (2016-04-30)
The main structural component of the mucus in the gastrointestinal tract is the MUC2 mucin. It forms large networks that in colon build the loose outer mucous layer that provides the habitat for the commensal flora and the inner mucous
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service