Skip to Content
Merck
CN

WH0001123M1

Monoclonal Anti-CHN1 antibody produced in mouse

clone 3F8, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-ARHGAP2, Anti-CHN, Anti-RHOGAP2, Anti-chimerin (chimaerin) 1

Sign In to View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3F8, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CHN1(1123)

General description

The gene chimerin 1 (CHN1) is mapped to human chromosome 2q31.1. It is mainly expressed in the brain. The gene encodes two splice variants, α1 and α2.
This gene encodes GTPase-activating protein for p21-rac and a phorbol ester receptor. It plays an important role in ocular motor axon pathfinding. Heterozygous missense mutations in this gene cause Duane′s retraction syndrome 2 (DURS2). Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

CHN1 (AAH11393, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTINPIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIP

Biochem/physiol Actions

Chimerin 1 (CHN1) works as a GTPase-activating protein (GAP) for Rac1 (Ras-related C3 botulinum toxin substrate 1). The α1-chimaerin controls dendritic spine growth, branching and morphology. Mutations in this gene are associated with Duane′s retraction syndrome (DRS).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Alpha1-chimaerin, a Rac1 GTPase-activating protein, is expressed at reduced mRNA levels in the brain of Alzheimer's disease patients.
Kato T
Neuroscience Letters, 591, 19-19 (2015)
Expansion of the CHN1 strabismus phenotype.
Miyake N
Investigative Ophthalmology & Visual Science, 52, 6321-6321 (2011)
Two novel CHN1 mutations in 2 families with Duane retraction syndrome.
Chan WM
Archives of Ophthalmology, 129, 649-652 (2011)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service