Skip to Content
Merck
CN
All Photos(5)

Key Documents

Safety Information

WH0000999M1

Sigma-Aldrich

Monoclonal Anti-CDH1 antibody produced in mouse

clone 3F4, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-Arc1, Anti-CDHE, Anti-ECAD, Anti-LCAM, Anti-UVO, Anti-cadherin 1, type 1, E-cadherin (epithelial)

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3F4, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CDH1(999)

General description

Cadherin 1 (CDH1), a transmembrane glycoprotein is present on the epithelial cell surface. It comprises a single transmembrane region, large extracellular domain, and a short cytoplasmic domain. The CDH1 gene is mapped to human chromosome 16q22.1. It is expressed in the embryonic stage especially during lip and palate development.

Immunogen

CDH1 (NP_004351, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV

Application

Monoclonal Anti-CDH1 antibody produced in mouse has been used in immunohistochemistry and western blotting. 1:2000

Biochem/physiol Actions

Cadherin 1 (CDH1) interacts with the actin cytoskeleton through its cytoplasmic domain. It plays a key role in epithelial cell-cell adhesion, maintaining tissue integrity, and migration of cells. CDH1 may also participate in the wingless (wnt) signal transduction pathway. Mutations in CDH1 are implicated in lobular breast cancer ovary cancer and blepharocheilodontic (BCD) syndrome characterized with cleft lip/palate, and ectodermal dysplasia.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Nives Pećina-Slaus
Cancer cell international, 3(1), 17-17 (2003-11-14)
E-cadherin tumor suppressor genes are particularly active area of research in development and tumorigenesis. The calcium-dependent interactions among E-cadherin molecules are critical for the formation and maintenance of adherent junctions in areas of epithelial cell-cell contact. Loss of E-cadherin-mediated-adhesion characterises
José Roberto F Caldeira et al.
BMC cancer, 6, 48-48 (2006-03-04)
The E-cadherin gene (CDH1) maps, at chromosome 16q22.1, a region often associated with loss of heterozygosity (LOH) in human breast cancer. LOH at this site is thought to lead to loss of function of this tumor suppressor gene and was
Jamal Ghoumid et al.
Genetics in medicine : official journal of the American College of Medical Genetics, 19(9), 1013-1021 (2017-03-17)
Blepharocheilodontic (BCD) syndrome is a rare autosomal dominant condition characterized by eyelid malformations, cleft lip/palate, and ectodermal dysplasia. The molecular basis of BCD syndrome remains unknown. We recruited 11 patients from 8 families and performed exome sequencing for 5 families
Catarina Roma-Rodrigues et al.
Bioorganic chemistry, 99, 103849-103849 (2020-04-24)
New hetero-arylidene-9(10H)-anthrone derivatives (1) were synthesized from reaction of 1,2-dimethyl-3-alkyl imidazolium salts (2) and 9-anthracenecarboxaldehyde. Ion exchange of the anion with dioctyl sulfosuccinate and lithium bis(trifluoromethanesulfonyl)imide led to the preparation of other derivatives. The antiproliferative effect of the compounds was
Stavroula Baritaki et al.
Cell cycle (Georgetown, Tex.), 9(24), 4931-4940 (2010-12-15)
The role of nitric oxide (NO) in cancer has been controversial and is based on the levels of NO and the responsiveness of the tumor type. It remains unclear whether NO can inhibit the epithelial to mesenchymal transition (EMT) in

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service