Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
Conjugate:
unconjugated
Clone:
2B7, monoclonal
Application:
ELISA (i)
Citations:
6
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2B7, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
isotype
IgG1κ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Quality Level
Gene Information
human ... CD81(975)
Looking for similar products? Visit Product Comparison Guide
General description
Cluster of differentiation 81(CD81), also known as target of antiproliferative antibody 1 (TAPA-1), is encoded by the gene mapped to human chromosome 11p15.5. The encoded protein belongs to the tetraspanin family and is mainly expressed on the oocyte surface. CD81 is characterized with a five large helical segments.
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. (provided by RefSeq)
Immunogen
CD81 (AAH02978, 25 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFY
Sequence
GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFY
Biochem/physiol Actions
Cluster of differentiation 81 (CD81) has a role in membrane organization, cell-cell interactions, cellular fusion and protein trafficking. It is also implicated in receptor clustering and signaling. CD81 acts as a putative receptor for hepatitis C virus (HCV) and facilitates the HCV glycoprotein-dependent viral cell entry. Elevated expression of the gene has been observed in various types of cancers.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
A role for CD81 and hepatitis C virus in hepatoma mobility.
Brimacombe CL
Viruses, 6, 1454-1472 (2014)
CD81 Is Required for Hepatitis C Virus Glycoprotein-Mediated Viral Infection
Zhang J
Journal of Virology, 78, 1448-1455 (2004)
Oligomerization of the Tetraspanin CD81 via the Flexibility of Its ?-Loop.
Schmidt TH
Biophysical Journal, 110, 2463-2474 (2016)
CD81 as a tumor target.
Vences-Catalan F
Biochemical Society Transactions, 45, 531-535 (2017)
A microarray-based DNA methylation study of
glioblastoma multiforme
Martinez R
Epigenetics, 4, 255-264 (2009)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service