Skip to Content
Merck
CN
All Photos(1)

Documents

Safety Information

SRP0164

Sigma-Aldrich

Histone H4 (2-58) human

recombinant, expressed in E. coli, ≥70% (SDS-PAGE)

Sign Into View Organizational & Contract Pricing

Synonym(s):
HIST2H4A
UNSPSC Code:
12352200
NACRES:
NA.77

biological source

human

recombinant

expressed in E. coli

Assay

≥70% (SDS-PAGE)

form

aqueous solution

mol wt

32 kDa

packaging

pkg of 500 μg

storage condition

avoid repeated freeze/thaw cycles

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−70°C

Gene Information

human ... HIST2H4A(8370)

General description

Human Histone 4 (GenBank Accession No. NM_003548), (2-58) with N-terminal GST-tag, MW = 32 kDa, expressed in an E. coli expression system.

Physical form

Formulated in 25 mM Tris-HCl, pH 8.0, 100 mM NaCl, 0.05% Tween-20, 20% glycerol and 3 mM DTT.

Preparation Note

Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot enzyme into single use aliquots. Store remaining undiluted enzyme in aliquots at -70°C. Note: Enzyme is very sensitive to freeze/thaw cycles.

Regulatory Information

新产品

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

  1. Which document(s) contains shelf-life or expiration date information for a given product?

    If available for a given product, the recommended re-test date or the expiration date can be found on the Certificate of Analysis.

  2. How do I get lot-specific information or a Certificate of Analysis?

    The lot specific COA document can be found by entering the lot number above under the "Documents" section.

  3. How do I find price and availability?

    There are several ways to find pricing and availability for our products. Once you log onto our website, you will find the price and availability displayed on the product detail page. You can contact any of our Customer Sales and Service offices to receive a quote.  USA customers:  1-800-325-3010 or view local office numbers.

  4. What is the Department of Transportation shipping information for this product?

    Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product. 

  5. What is the amino acid sequence of Histone H4 (2-58) human, Product SRP0164?

    The sequence for Product SRP0164, Histone H4 (2-58) human is as follows:SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV

  6. My question is not addressed here, how can I contact Technical Service for assistance?

    Ask a Scientist here.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service