Skip to Content
Merck
CN
All Photos(1)

Documents

Safety Information

SRP0158

Sigma-Aldrich

Histone H3 (2-58) human

recombinant, expressed in E. coli, ≥70% (SDS-PAGE)

Sign Into View Organizational & Contract Pricing
All Photos(1)
Synonym(s):
HIST1H3E, Histone H3.1
UNSPSC Code:
12352200
NACRES:
NA.32

biological source

human

recombinant

expressed in E. coli

Assay

≥70% (SDS-PAGE)

form

aqueous solution

mol wt

32 kDa

packaging

pkg of 500 μg

storage condition

avoid repeated freeze/thaw cycles

concentration

>0.02 mg/mL

NCBI accession no.

NM_003532

UniProt accession no.

P68431

shipped in

dry ice

storage temp.

−70°C

Gene Information

human ... HIST1H3E(8353)

General description

The mammalian chromatin is present in nucleosomes, made of histone octamers (H2A,H2B,H3,H4)2. Mammals contain three main classes of histone H3 variants: the replicative histones (H3.1 and H3.2), the replacement histone (H3.3) and the centromeric histone (Cenp-A).
Human Histone 3 (GenBank Accession No. NM_003532), (amino acid 2-58) with N-terminal GST tag, MW = 32kDa, expressed in an Escherichia coli expression system.

Application

Suitable substrate for histone methyltransferases

Biochem/physiol Actions

Histone proteins are basic building blocks of chromatin. H3.1 (also referred to as HIST1H3E) is mainly expressed in the S phase and is termed as replication-dependent histone. Selective methylation of H3.1 controls replication in heterochromatin area.

Physical form

Formulated in 25 mM Tris-HCl, pH 8.0, 100 mM NaCl, 0.05% Tween-20, 20% glycerol and 3 mM DTT.

Preparation Note

Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot enzyme into single use aliquots. Store remaining undiluted enzyme in aliquots at -70°C. Note: Enzyme is very sensitive to freeze/thaw cycles.

Regulatory Information

新产品

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

  1. Which document(s) contains shelf-life or expiration date information for a given product?

    If available for a given product, the recommended re-test date or the expiration date can be found on the Certificate of Analysis.

  2. How do I get lot-specific information or a Certificate of Analysis?

    The lot specific COA document can be found by entering the lot number above under the "Documents" section.

  3. How do I find price and availability?

    There are several ways to find pricing and availability for our products. Once you log onto our website, you will find the price and availability displayed on the product detail page. You can contact any of our Customer Sales and Service offices to receive a quote.  USA customers:  1-800-325-3010 or view local office numbers.

  4. What is the Department of Transportation shipping information for this product?

    Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product. 

  5. What is the amino acid sequence of Histone H3 (2-58) human, product SRP0158?

    The sequence for product SRP0158, Histone H3 (2-58) human, is as follows:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS

  6. My question is not addressed here, how can I contact Technical Service for assistance?

    Ask a Scientist here.

Selective methylation of histone H3 variant H3.1 regulates heterochromatin replication.
Jacob Y, et al.
Science, 343, 1249-1249 (2014)
Topography of the histone octamer surface: repeating structural motifs utilized in the docking of nucleosomal DNA.
Arents G and Moudrianakis EN
Proceedings of the National Academy of Sciences of the USA, 90, 10489-10489 (1993)
Genome-wide analysis of histone H3 lysine 4 trimethylation in peripheral blood mononuclear cells of minimal change nephrotic syndrome patients.
Zhang L, et al.
American Journal of Nephrology, 30, 505-505 (2009)
Eric I Campos et al.
Nature structural & molecular biology, 17(11), 1343-1351 (2010-10-19)
The mechanism by which newly synthesized histones are imported into the nucleus and deposited onto replicating chromatin alongside segregating nucleosomal counterparts is poorly understood, yet this program is expected to bear on the putative epigenetic nature of histone post-translational modifications.
Alejandra Loyola et al.
Molecular cell, 24(2), 309-316 (2006-10-21)
Histone posttranslational modifications (PTMs) and sequence variants regulate genome function. Although accumulating evidence links particular PTM patterns with specific genomic loci, our knowledge concerning where and when these PTMs are imposed remains limited. Here, we find that lysine methylation is
View All Related Papers

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service