SAB2109036
Anti-Atat1 antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(1)
3110080J08Rik, FLJ13158|Mec17|TAT
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
46 kDa
species reactivity (predicted by homology)
rat, bovine, human, rabbit, canine, horse, mouse, guinea pig
concentration
0.5 mg/mL
technique(s)
western blot: 1 μg/mL
NCBI accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ATAT1(79969)
General description
Atat1 specifically acetylates ′Lys-40′ in alpha-tubulin on the lumenal side of microtubules. Atat1 may affect microtubule stability and regulate microtubule dynamics and may be involved in neuron development.
Immunogen
Synthetic peptide directed towards the middle region of Rat Atat1
Sequence
Synthetic peptide located within the following region: WPLNRAPRRATPPAHPPPRSSSLGNSPDRGPLRPFVPEQELLRSLRLCPP
Physical form
Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
nwg
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Cellular and molecular life sciences : CMLS, 81(1), 12-12 (2023-12-22)
Friedreich ataxia (FA) is a rare, recessive neuro-cardiodegenerative disease caused by deficiency of the mitochondrial protein frataxin. Mitochondrial dysfunction, a reduction in the activity of iron-sulfur enzymes, iron accumulation, and increased oxidative stress have been described. Dorsal root ganglion (DRG)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service