All Photos(3)
Synonym(s):
Anti- GLS, Anti- LGA, Anti- MGC71567, Anti- hLGA, Anti-GA
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
36 kDa
species reactivity
rat, horse, mouse, human, dog, pig
concentration
0.5-1 mg/mL
technique(s)
immunoblotting: suitable
immunohistochemistry: suitable
accession no.
NM_013267
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GLS2(27165)
General description
Glutaminase 2 (GLS2) is located in mitochondria and nucleus. The gene is located on human chromosome 12q13. GLS2 protein is expressed in brain, pancreas, cancer cells and cells of the immune system.
Immunogen
Synthetic peptide directed towards the middle region of human GLS2
Biochem/physiol Actions
Glutaminase 2 (GLS2) is a mitochondrial phosphate-activated glutaminase that catalyses the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.
GLS2 functions as a tumor protein p53 downstream target gene. GLS2 controls the functions of p53, in modulating energy metabolism and antioxidant defense. It might play a critical role in tumorigenesis. The protein negatively controls PI3K (phosphatidylinositol 3-kinase) /AKT (non-specific serine/threonine protein kinase) signalling pathway. GLS2 regulates the neuronal effects of tumor protein p73. The protein might have a pivotal role in radioresistance in cervical cancer patients.
GLS2 functions as a tumor protein p53 downstream target gene. GLS2 controls the functions of p53, in modulating energy metabolism and antioxidant defense. It might play a critical role in tumorigenesis. The protein negatively controls PI3K (phosphatidylinositol 3-kinase) /AKT (non-specific serine/threonine protein kinase) signalling pathway. GLS2 regulates the neuronal effects of tumor protein p73. The protein might have a pivotal role in radioresistance in cervical cancer patients.
Sequence
Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Knock-down of glutaminase 2 expression decreases glutathione, NADH, and sensitizes cervical cancer to ionizing radiation
Xiang L, et al.
Biochimica et Biophysica Acta (BBA)-Gene Structure and Expression, 1833(12), 2996-3005 (2013)
Expression of Gls and Gls2 glutaminase isoforms in astrocytes
Cardona C, et al.
Glia, 63(3), 365-382 (2015)
GLS2 is transcriptionally regulated by p73 and contributes to neuronal differentiation
Velletri T, et al.
Cell Cycle, 12(22), 3564-3573 (2013)
Mercedes Martín-Rufián et al.
PloS one, 7(6), e38380-e38380 (2012-06-09)
Glutaminase is expressed in most mammalian tissues and cancer cells, but the regulation of its expression is poorly understood. An essential step to accomplish this goal is the characterization of its species- and cell-specific isoenzyme pattern of expression. Our aim
Juan Liu et al.
Oncotarget, 5(9), 2635-2647 (2014-05-07)
The tumor suppressor p53 and its signaling pathway play a critical role in tumor prevention. As a direct p53 target gene, the role of glutaminase 2 (GLS2) in tumorigenesis is unclear. In this study, we found that GLS2 expression is
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service