SAB2108004
Anti-BDNF antibody produced in rabbit
Synonym(s):
Anti-ANON2, Anti-BULN2
Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
clone
polyclonal
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
form
buffered aqueous solution
mol wt
27kDa
species reactivity
horse, rat, rabbit, dog, mouse, human, pig
concentration
0.5 mg - 1 mg/mL
technique(s)
immunoblotting: suitable
immunohistochemistry: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Quality Level
Gene Information
human ... BDNF(627)
Application
Anti-BDNF antibody produced in rabbit has been used in immunohistochemistry and western blotting.
Biochem/physiol Actions
Brain derived neurotrophic factor (BDNF) is involved in hippocampal function and verbal episodic memory in humans. Hence, variation in the BDNF gene expression alters these neurological functions. BDNF also plays a vital role in vascular function and participates in angiogenesis via the specific receptor tropomyosin-related kinase B (TrkB). It is involved in the pathogenesis of Alzheimer′s disease. ProBDNF interacts with p75 neurotrophin receptor, leading to long-term depression in the hippocampus.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
The brain derived neurotrophic factor (BDNF) gene is mapped to human chromosome 11p14.1. BDNF is a member of the neurotrophin family of growth factors. The gene encodes a precursor protein, proBDNF. Mature BDNF (mBDNF) is synthesized by post-translational cleavage of proBDNF. Both proBDNF and mBDNF play crucial roles in cellular signaling.
Immunogen
Synthetic peptide directed towards the middle region of human BDNF
Other Notes
Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Running wheel exercise reduces a-synuclein aggregation and improves motor and cognitive function in a transgenic mouse model of Parkinson's disease
Zhou W, et al.
PLoS ONE, 12 (2017)
Expression of nerve growth factor and brain-derived neurotrophic factor in astrocytomas.
Liu TT, et al.
Oncology Letters, 15, 533-537 (2018)
Qiuping Zhong et al.
Progress in neuro-psychopharmacology & biological psychiatry, 90, 62-75 (2018-11-06)
The canonical phosphodiesterase 4 (PDE4) inhibitors produce antidepressant-like effects in a variety of animal models. However, severe side effects, particularly vomiting and nausea, limit their clinical application. FCPR16 is a novel PDE4 inhibitor with less vomiting potential. However, whether it
Molecular examination of bone marrow stromal cells and chondroitinase ABC-assisted acellular nerve allograft for peripheral nerve regeneration
Wang Y, et al.
Experimental and Therapeutic Medicine, 12, 1980-1992 (2016)
Hui Yu et al.
The international journal of neuropsychopharmacology, 22(2), 143-156 (2018-11-09)
Phosphodiesterase 4 is a promising target for developing novel antidepressants. However, prototype phosphodiesterase 4 inhibitors show severe side effects, including nausea and vomiting. N-Isopropyl-3-(cyclopropylmethoxy)-4-difluoromethoxy benzamide (FCPR03) is a novel phosphodiesterase 4 inhibitor with little emetic potential. In the present study
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service