SAB1412447
ANTI-HOXB7 antibody produced in mouse
clone 4C6, purified immunoglobulin, buffered aqueous solution
Sign Into View Organizational & Contract Pricing
All Photos(3)
HHO.C1, HOX2, HOX2C, HOXB7, Hox-2.3
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
4C6, monoclonal
form
buffered aqueous solution
mol wt
antigen 33 kDa
species reactivity
human
technique(s)
immunohistochemistry: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG1κ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... HOXB7(3217)
General description
Homeobox B7 (HOXB7) is part of the HOX gene family and is expressed in embryonic tissues. The gene encoding it is localized on human chromosome 17q21.32.
Immunogen
HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
Sequence
MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
Biochem/physiol Actions
Homeobox B7 (HOXB7) has a role in many cellular processes. It has been shown to be expressed in hepatocellular carcinoma. HOXB7 may also have a role in cell migration and invasion in gastric cancer. This transcription factor is vital for tissue differentiation and embryogenesis. HOXB7 may be a potential drug target in various cancers. The protein has the capacity to induce the expression of genes associated with tumor invasion and angiogenesis.
Physical form
Solution in phosphate buffered saline, pH 7.4
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
HOXB7-S3 inhibits the proliferation and invasion of MCF-7 human breast cancer cells.
Molecular Medicine Reports, 12, 4901-4908 (2015)
Identification of several potential chromatin binding sites of HOXB7 and its downstream target genes in breast cancer.
International Journal of Cancer. Journal International Du Cancer, 137, 2374-2383 (2015)
The roles of HOXB7 in promoting migration, invasion, and anti-apoptosis in gastric cancer.
Journal of Gastroenterology and Hepatology, 31, 1717-1726 (2016)
HOXB7 mRNA is overexpressed in pancreatic ductal adenocarcinomas and its knockdown induces cell cycle arrest and apoptosis.
BMC Cancer (2013)
Frontiers in cell and developmental biology, 9, 697086-697086 (2021-08-31)
Diffuse glioma is the most common primary tumor of the central nervous system. The prognosis of the individual tumor is heavily dependent on its grade and subtype. Homeobox B7 (HOXB7), a member of the homeobox family, is abnormally overexpressed in
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service