SAB1412393
ANTI-SREBF1 antibody produced in mouse
clone 4G4, purified immunoglobulin, buffered aqueous solution
Sign Into View Organizational & Contract Pricing
All Photos(3)
SREBF1, SREBP-1c, SREBP1, bHLHd1
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
4G4, monoclonal
form
buffered aqueous solution
mol wt
antigen 36.63 kDa
species reactivity
human
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SREBF1(6720)
General description
Sterol regulatory element binding transcription factor 1 (SREBF1) gene is located on human chromosome 17p11.2. SREBF1 encodes the transcription factors SREBP-1a and SREBP-1c. SREBP-1a is expressed in spleen and intestine.SREBP-1c is expressed in liver, adipose tissue and skeletal muscle.
Immunogen
SREBF1 (AAH57388, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
Sequence
VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
Biochem/physiol Actions
Sterol regulatory element binding transcription factor 1 (SREBF1) regulates lipogenesis, energy homeostasis and insulin sensitivity. It is associated with non-alcoholic fatty liver disease (NAFLD). SREBF1 promotes tumor growth in various cancers. SREBF1 acts as a molecular bridge between lipogenesis and cell cycle control clear cell renal carcinoma.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
54G/C polymorphism of SREBF-1 gene is associated with polycystic ovary syndrome
European Journal of Obstetrics, Gynecology, and Reproductive Biology, 188, 95-99 (2015)
SREBP-1c as a molecular bridge between lipogenesis and cell cycle progression of clear cell renal carcinoma
Bioscience Reports, BSR20171270-BSR20171270 (2017)
Lack of association between SREBF-1c gene polymorphisms and risk of non-alcoholic fatty liver disease in a Chinese Han population
Scientific reports, 6, 32110-32110 (2016)
Association of variants in the sterol regulatory element-binding factor 1 gene (SREBF1) with type 2 diabetes, glycemia, and insulin resistance-A study of 15,734 Danish subjects
Diabetes (2008)
Structure of the human gene encoding sterol regulatory element binding protein-1 (SREBF1) and localization of SREBF1 and SREBF2 to chromosomes 17p11. 2 and 22q13.
Genomics, 25(3), 667-673 (1995)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service