Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
4E3, monoclonal
form
buffered aqueous solution
mol wt
antigen 8.69 kDa
species reactivity
human
technique(s)
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2bκ
NCBI accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... IL8(3576)
Related Categories
General description
Interleukin 8 (IL-8) is an 8& kDa, 72 amino acid residue containing cytokine that belongs to C-X-C chemokine family. The IL-8 gene is mapped to human chromosomes 4q13.3. IL-8 chemokine is secreted by several cell types. The IL-8 gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection.
Immunogen
IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein.
Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Biochem/physiol Actions
Elevated expression of IL-8 gene is observed in a number of cancers including chronic spontaneous urticaria and breast cancer, thus serves as a prognostic marker for the same. IL-8 regulates the metastasis and angiogenesis processes during cancer development. IL-8 is responsible for epithelial–mesenchymal transition which plays an important role in providing cancer cells the mobility to invade other neighbouring cells, thereby contributing to metastasis.
Interleukin-8 (IL-8) chemoattracts and activates neutrophils. It is involved in guiding neutrophils and oligodendrocytes to sites of infection. The protein also stimulates angiogenesis and tumor growth. It is also associated with inflammatory diseases.
Physical form
Solution in phosphate buffered saline, pH 7.4
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Purification of a human monocyte-derived neutrophil chemotactic factor that has peptide sequence similarity to other host defense cytokines.
Yoshimura T, et al.
Proceedings of the National Academy of Sciences of the USA, 84(24), 9233-9237 (1987)
Interleukin 8: cells of origin in inflammatory bowel disease.
Grimm M C, et al.
Gut, 38(1), 90-98 (1996)
Elevated plasma il-8 concentration is related to severity of systemic inflammation in chronic spontaneous urticaria.
Kasperska-Zajac A, et al.
Journal of Biological Regulators and Homeostatic Agents, 31(4), 957-961 (2017)
Sohlh2 suppresses epithelial to mesenchymal transition in breast cancer via downregulation of IL-8.
Ji S, et al.
Oncotarget, 7(31), 49411-49411 (2016)
Qi Sun et al.
International journal of clinical and experimental pathology, 8(7), 8376-8384 (2015-09-05)
Interleukin-8 (IL-8), matrix metalloproteinase-9 (MMP-9) and neovascularization have been implicated to be associated with biological processes, especially cancer progression. However, few studies have investigated the role of IL-8 in human hilar cholangiocarcinoma. In this study we detected the expression of
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service