SAB1405525
Anti-TSPO antibody produced in mouse
purified immunoglobulin, buffered aqueous solution
Sign Into View Organizational & Contract Pricing
All Photos(1)
Synonym(s):
BZRP, DBI, IBP, MBR, PBR, PKBS, PTBR, TSPO Antibody - Anti-TSPO antibody produced in mouse, Tspo Antibody, mDRC, pk18
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
antigen ~18.8 kDa
species reactivity
human
technique(s)
western blot: 1 μg/mL
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... TSPO(706)
General description
Translocator protein (TSPO) contains five α helices. The TSPO gene is mapped to human chromosome 22q13.2. It is expressed in activated microglia.
Immunogen
TSPO (AAH01110.1, 1 a.a. ~ 169 a.a) full-length human protein.
Sequence
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE
Sequence
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE
Application
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Flow cytometry/Cell sorting (1 paper)
Flow cytometry/Cell sorting (1 paper)
Biochem/physiol Actions
Translocator protein (TSPO) serves as a marker for microglial activation. The levels of TSPO are elevated in multiple sclerosis, Huntington′s disease (HD), and brain ischemia as well as in gliomas. TSPO functions as a key target for understanding neuroinflammation and has applications in positron emission tomography (PET) imaging. It also binds to cholesterol. The TSPO gene polymorphism may be associated with the pathophysiology of panic attacks, bipolar disorder, and anxiety. Together with voltage-dependent anion channel (VDAC), TSPO regulates terminal erythropoiesis as well as autophagy in mitochondria.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Laura Airas et al.
Clinical and translational imaging, 3, 461-473 (2015-01-01)
Conventional MR imaging (MRI) techniques form the cornerstone of multiple sclerosis (MS) diagnostics and clinical follow-up today. MRI is sensitive in demonstrating focal inflammatory lesions and diffuse atrophy. However, especially in progressive MS, there is increasingly widespread diffuse pathology also
Hien T T Lai et al.
Molecules (Basel, Switzerland), 26(5) (2021-03-04)
The translocator protein (TSPO) is a 18kDa transmembrane protein, ubiquitously present in human mitochondria. It is overexpressed in tumor cells and at the sites of neuroinflammation, thus representing an important biomarker, as well as a promising drug target. In mammalian
Biljana Musicki et al.
Journal of cellular physiology, 236(4), 3073-3082 (2020-09-26)
Priapism, a prolonged penile erection in the absence of sexual arousal, is common among patients with sickle cell disease (SCD). Hypogonadism is also common in patients with SCD. While the administration of exogenous testosterone reverses hypogonadism, it is contraceptive. We
Martina Moras et al.
International journal of molecular sciences, 21(23) (2020-12-03)
Translocator protein (TSPO) and voltage dependent anion channels (VDAC) are two proteins forming a macromolecular complex in the outer mitochondrial membrane that is involved in pleiotropic functions. Specifically, these proteins were described to regulate the clearance of damaged mitochondria by
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service