Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2C11, monoclonal
form
buffered aqueous solution
mol wt
antigen ~29.85 kDa
species reactivity
human
technique(s)
capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... POLD4(57804)
General description
Mammalian DNA polymerase (Pol) δ contains four subunits, p125, p50, p68, and p12. DNA polymerase δ 4, accessory subunit (POLD4) is the smallest subunit of DNA polymerase δ. POLD4 gene is located on human chromosome 11q13.2.
Immunogen
POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
Sequence
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
Biochem/physiol Actions
Mammalian DNA polymerase (Pol) δ plays a key role in DNA replication. DNA polymerase δ 4, accessory subunit (POLD4) is involved in cell cycle progression. It helps to maintain the genomic stability of human cells. p12 is essential for the optimal activity of human Pol δ. p12 helps to stabilize Pol holoenzyme. Interaction of p12 with PCNA also aids in stabilizing the Pol-proliferating cell nuclear antigen (PCNA) complex. Lower expression of the POLD4 gene might participate in the progression of lung cancer.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Qin Miao Huang et al.
Biochemical and biophysical research communications, 391(1), 542-546 (2009-11-26)
Mammalian DNA polymerase delta (pol delta) is essential for DNA replication, though the functions of this smallest subunit of POLD4 have been elusive. We investigated pol delta activities in vitro and found that it was less active in the absence
Qin Miao Huang et al.
Cancer research, 70(21), 8407-8416 (2010-09-24)
Genomic instability is an important factor in cancer susceptibility, but a mechanistic understanding of how it arises remains unclear. We examined hypothesized contributions of the replicative DNA polymerase δ (pol δ) subunit POLD4 to the generation of genomic instability in
Melanie Haas Kucherlapati
Oncotarget, 10(65), 6913-6933 (2019-12-21)
Genes of the pre-replication, pre-initiation and replisome complexes duplicate the genome from many sites once in a normal cell cycle. This study examines complex components in lung adenocarcinoma (LUAD) closely, correlating changes in the genome and transcriptome with proliferation and
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service