SAB1404141
Monoclonal Anti-NOVA1, (C-terminal) antibody produced in mouse
clone 5D9, purified immunoglobulin, buffered aqueous solution
Sign Into View Organizational & Contract Pricing
All Photos(2)
Synonym(s):
Nova-1
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
5D9, monoclonal
form
buffered aqueous solution
mol wt
antigen ~37.11 kDa
species reactivity
rat, human
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG1κ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... NOVA1(4857)
General description
This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described. (provided by RefSeq)
Immunogen
NOVA1 (NP_002506, 408 a.a. ~ 507 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG
Sequence
SAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG
Application
Monoclonal Anti-NOVA1, (C-terminal) antibody produced in mouse is suitable for indirect ELISA and western blot analysis.
Biochem/physiol Actions
NOVA1 is associated with several post-transcriptional regulation of RNA metabolism including RNA splicing, editing to transport, localization, and degradation. It may be involved in mediating neuronal responsiveness. It encodes a protein which has homology with the RNA-binding protein hnRNP K, the yeast splicing protein MER1. Since, it has some homology with hnRNP K, it may influence the regulation of RNA splicing or metabolism in developing neurons. The importance of NOVA1 as prognostic marker has been reported in HCC (Hepatocellular carcinoma). Alteration in gene causes a disorder associated with breast cancer and motor dysfunction i.e. paraneoplastic opsoclonus myoclonus ataxia (POMA).
Physical form
Solution in phosphate buffered saline, pH 7.4
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
R J Buckanovich et al.
Neuron, 11(4), 657-672 (1993-10-01)
Paraneoplastic opsoclonus-ataxia, a disorder of motor control, develops in breast or lung cancer patients who harbor an antibody (Ri) that recognizes their tumors and a nuclear neuronal protein of 55 kd. We have characterized a gene, Nova, encoding an antigen
Yi-An Zhang et al.
PloS one, 9(3), e90955-e90955 (2014-03-13)
Neuro-oncological ventral antigen 1 (Nova1) is a neuron-specific RNA-binding protein in human paraneoplastic opsoclonus-myoclonus ataxia accompanying with malignant tumors, but its role in hepatocellular carcinoma (HCC) remains elusive. In this study, we found that overexpressed intratumoral Nova1 was associated with
R J Buckanovich et al.
Molecular and cellular biology, 17(6), 3194-3201 (1997-06-01)
Nova-1, an autoantigen in paraneoplastic opsoclonus myoclonus ataxia (POMA), a disorder associated with breast cancer and motor dysfunction, is a neuron-specific nuclear RNA binding protein. We have identified in vivo Nova-1 RNA ligands by combining affinity-elution-based RNA selection with protein-RNA
Hualing Li et al.
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society, 61(1), 45-54 (2012-10-09)
The present study aimed to evaluate the expression of neuro-oncological ventral antigen 1 (Nova1) in cerebral ischemia/reperfusion (I/R) insults by immunohistochemistry. The focal cerebral I/R model was induced by right middle cerebral artery occlusion (MCAO) for 120 min followed by
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service