SAB1403916
Monoclonal Anti-HIF1A, (C-terminal) antibody produced in mouse
clone 1D4, purified immunoglobulin, buffered aqueous solution
Synonym(s):
HIF-1alpha, HIF1, HIF1-ALPHA, MOP1, PASD8, bHLHe78
Select a Size
¥11,407.80
Select a Size
About This Item
¥11,407.80
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
1D4, monoclonal
form
buffered aqueous solution
mol wt
antigen ~38.21 kDa
species reactivity
human
technique(s)
capture ELISA: suitable
indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL
Related Categories
1 of 4
This Item | 67034U | 67033U | 66825U |
---|---|---|---|
matrix spherical silica particle platform, superficially porous particle | matrix spherical silica particle platform, superficially porous particle | matrix spherical silica particle platform, superficially porous particle | matrix spherical silica particle platform, superficially porous particle |
separation technique reversed phase | separation technique reversed phase | separation technique reversed phase | separation technique reversed phase |
particle size 3.4 μm | particle size 3.4 μm | particle size 3.4 μm | particle size 3.4 μm |
matrix active group C4 (butyl) phase | matrix active group C4 (butyl) phase | matrix active group C4 (butyl) phase | matrix active group C4 (butyl) phase |
pore size 400 Å | pore size 400 Å | pore size 400 Å | pore size 400 Å |
technique(s) HPLC: suitable, UHPLC-MS: suitable, LC/MS: suitable, UHPLC: suitable | technique(s) HPLC: suitable, LC/MS: suitable, UHPLC-MS: suitable, UHPLC: suitable | technique(s) HPLC: suitable, LC/MS: suitable, UHPLC-MS: suitable, UHPLC: suitable | technique(s) HPLC: suitable, LC/MS: suitable, UHPLC-MS: suitable, UHPLC: suitable |
General description
Immunogen
Sequence
QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Physical form
Disclaimer
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service