Monoclonal Anti-LAMP2 antibody produced in mouse

The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. (provided by RefSeq) Lysosome-associated membrane protein 2 (LAMP2) is expressed in the lysosomal lumen and membrane. In the tumor microenvironment, it is found to be present in the plasma membrane. The gene encoding this protein is localized on human chromosome Xq24.

LAMP2 (NP_054701, 30 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP

Monoclonal Anti-LAMP2 antibody produced in mouse has been used in immunofluorescence.

Lysosome-associated membrane protein 2 (LAMP2) protects lysosomal membranes from acid proteolysis. It serves as an acidity biomarker in spheroids and xenografts.The protein also has a role in maturation of autophagic vacuoles and cell-cell or cell-extracellular matrix adhesion. Mutation in the LAMP2 gene has been linked to cardiomyopathy in young patients.

Solution in phosphate buffered saline, pH 7.4

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.