Anti-IL6 antibody produced in mouse

IL-6 (Interleukin-6) is a proinflammatory cytokine that plays an important role in the maturation of B cells into antibody producing cells. It is also expressed by resting T-cells and induces IL-2 receptor and IL-2 production n mitogen-stimulated T cells and thymocytes. IL-6 functions in the activation and proliferation of T-cells. It participates in hematopoiesis by activating hematopoietic stem cells at the G₀ stage to enter into the G1 phase. Increased levels of IL-6 and C-reactive protein have been observed in type-2 diabetes mellitus.

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Human IL-6 (Interleukin-6) gene maps to chromosome 7p15. It is found to be mainly expressed in lymphoid and non-lymphoid cells, such as T-cells, B-cells, monocytes, fibroblasts, keratinocytes, endothelial cells and mesangium cells. It encodes a 184 amino acid protein that contains two potential N-glycosylation sites and four cysteine residues.

This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. (provided by RefSeq)

IL6 (AAH15511, 1 a.a. ~ 212 a.a) full-length human protein.

Sequence
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Solution in phosphate buffered saline, pH 7.4