MSST0059
SILu™Prot CST3, Cystatin C human
recombinant, expressed in E. coli, SIL MS Protein Standard, 15N-labeled
Synonym(s):
CST3, Cystatin C
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
recombinant
expressed in E. coli
Quality Level
Assay
≥95% (SDS-PAGE)
form
lyophilized powder
potency
≥97% (Heavy amino acids incorporation efficiency by MS)
suitability
suitable for mass spectrometry (standard)
UniProt accession no.
shipped in
ambient
storage temp.
−20°C
Gene Information
human ... CST3(1471)
Related Categories
General description
SILu™Prot CST3 is a recombinant, stable 15N isotope-labeled human CST3. Expressed in E. coli, it is designed to be used as an internal standard for bioanalysis of CST3 in mass-spectrometry. SILu™Prot CST3 is a protein of 120 amino acids, with a calculated molecular mass of 13.5 kDa.
Biochem/physiol Actions
Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Measurement of cystatin C in serum is replacing creatinine as an indicator of kidney function (glomerular filtration rate, GFR).
Sequence
SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Physical form
Supplied as a lyophilized powder containing tris buffered saline and methionine.
Legal Information
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC
WGK
WGK 2
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service