M1882
Myoglobin from equine heart
≥90% (SDS-PAGE), essentially salt-free, lyophilized powder
Recommended Products
biological source
equine heart
Quality Level
Assay
≥90% (SDS-PAGE)
form
essentially salt-free, lyophilized powder
Iron content
≥0.20%
technique(s)
MALDI-MS: suitable
UniProt accession no.
storage temp.
−20°C
Gene Information
horse ... MB(100054434)
Looking for similar products? Visit Product Comparison Guide
Application
- spectral measurements in Beckman DU-50 or Gilford 2400 spectrophotometer
- the secondary structure analysis of proteins in H2O solution using single-pass attenuated total reflection Fourier transform infrared (ATR-FT-IR) microscopy
- the calibration of the mass scale at a concentration of 2 pmol/μL in Electrospray mass spectrometry
- a study to investigate on-line single droplet deposition for MALDI mass spectrometry
- a study to examine protein adsorption in fused-silica and polyacrylamide-coated capillaries
Biochem/physiol Actions
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
Regulatory Information
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Which document(s) contains shelf-life or expiration date information for a given product?
If available for a given product, the recommended re-test date or the expiration date can be found on the Certificate of Analysis.
How do I get lot-specific information or a Certificate of Analysis?
The lot specific COA document can be found by entering the lot number above under the "Documents" section.
What is the molecular weight of Product M1882, Myoglobin from equine heart?
Based on the amino acid sequence (16,950) plus the heme group (616), the molecular weight is approximately 17,600 g/mol.
Is Product M1882, Myoglobin from equine heart, oxidized?
Yes, it is oxidized.
Is Product M1882, Myoglobin from equine heart, metmyoglobin?
The M1882 is a mixture, but we have not analyzed the percentages of the oxidized myoglobin or the reduced myoglobin in the product.
Which has more affinity for oxygen, hemoglobin or myoglobin?
The affinity of myoglobin for oxygen is higher than that of hemoglobin.
How do I find price and availability?
There are several ways to find pricing and availability for our products. Once you log onto our website, you will find the price and availability displayed on the product detail page. You can contact any of our Customer Sales and Service offices to receive a quote. USA customers: 1-800-325-3010 or view local office numbers.
What is the Department of Transportation shipping information for this product?
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Do you have the sequence for Product M1882, Myoglobin from equine heart?
Product M1882 - Myoglobin from equine heart is purified from equine heart. It is not sequenced.Accession P68082 for equine myoglobin has the following sequenceMGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQGI hope that you find this information helpful.If you have further questions, please reply to this email.Sincerely,Audrey FlemingSigma-Aldrich Technical Service
My question is not addressed here, how can I contact Technical Service for assistance?
Ask a Scientist here.
Articles
Rapid trypsin digest kit yields reliable results in less than 2 hours for mass spectrometry analysis.
Chromatograms
application for HPLCOur team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service