Recommended Products
biological source
bovine milk
Quality Level
Assay
≥90% (PAGE)
form
powder
mol wt
18,363 Da by calculation
technique(s)
HPLC: suitable
UniProt accession no.
storage temp.
2-8°C
Gene Information
bovine ... LGB(280838)
Looking for similar products? Visit Product Comparison Guide
General description
Application
- as a calibrant for the calibration of the TriWave device
- as a standard in the detection and quantification of β-lactoglobulin in bovine milk by reverse-phase high performance liquid chromatography (HPLC)
- in the purification and molecular weight measurement of protease samples
Biochem/physiol Actions
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
Regulatory Information
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Which document(s) contains shelf-life or expiration date information for a given product?
If available for a given product, the recommended re-test date or the expiration date can be found on the Certificate of Analysis.
How do I get lot-specific information or a Certificate of Analysis?
The lot specific COA document can be found by entering the lot number above under the "Documents" section.
How do I find price and availability?
There are several ways to find pricing and availability for our products. Once you log onto our website, you will find the price and availability displayed on the product detail page. You can contact any of our Customer Sales and Service offices to receive a quote. USA customers: 1-800-325-3010 or view local office numbers.
What is the Department of Transportation shipping information for this product?
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Do you have the amino acid sequence of Product L7880, β-Lactoglobulin A from bovine milk?
Uniprot P02754 describes beta Lactoglobulin.The first 16 amino acids of that sequence are the signal peptide, so the sequence of beta-Lactoglobulin B corresponds to amino acids 17-178.But Product L7880 is beta-Lactoglobulin A. As shown in the details under the first link, this form of the protein varies by two amino acids from beta-Lactoglobulin B:1. Instead of the glycine (G) at position 80 of the B form, the A form has an aspartic acid (D).2. Instead of the alaline (A) at position 134 of the B form, the A form has a valine (V).So to answer your question, the sequence of Product L7880 is:LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
My question is not addressed here, how can I contact Technical Service for assistance?
Ask a Scientist here.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service