Skip to Content
Merck
CN

HPA041402

Anti-CARMIL2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-LRRC16C, Anti-RLTPR, Anti-Carmil2, Anti-Lrrc16c, Anti-Rgd motif, leucine rich repeats, tropomodulin domain and proline-rich containing

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
5
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

EVNELCQSVQEHVELLGCGAGPQGEAAVRQAEDAIQNANFSLSILPILYEAGSSPSHHWQLGQKLEGLLRQVGEVCRQDIQDFTQ

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... RLTPR(146206)

General description

The gene CARMIL2 (capping protein regulator and myosin 1 linker 2) is mapped to human chromosome 16q22.1. The encoded protein belongs to the CARMIL family of proteins. The protein has a noncanonical pleckstrin homology domain, a leucine-rich repeat domain, a helical homodimerization domain and a disordered region that contains the CBR (CP-binding region) and a proline-rich domain, which binds to class-I myosins. CARMIL2 is also referred to as RLTPR (RGD, leucine-rich repeat, tropomodulin and proline-rich-containing protein).

Immunogen

capping protein regulator and myosin 1 linker 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-RLTPR antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

CARMIL (capping protein regulator and myosin 1 linker) proteins are mainly involved in cell migration. CARMIL proteins interact with capping protein (CP). In migrating cells, CARMIL2 (also referred to as RLTPR) regulates cell polarity. It also interacts with vimentin intermediate filaments. CARMIL2 is needed for cell migration in wound healing and invadopodia-induced matrix degradation.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST82234

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Cell Migration and Invadopodia Formation Require a Membrane-binding Domain of CARMIL2.
Lanier MH, et al.
The Journal of Biological Chemistry, 291, 1076-1091 (2016)
Thomas Magg et al.
Inflammatory bowel diseases, 25(11), 1788-1795 (2019-05-23)
Children with very early onset inflammatory bowel diseases (VEO-IBD) often have a refractory and severe disease course. A significant number of described VEO-IBD-causing monogenic disorders can be attributed to defects in immune-related genes. The diagnosis of the underlying primary immunodeficiency
Distinct roles for CARMIL isoforms in cell migration.
Liang Y, et al.
Molecular Biology of the Cell, 20, 5290-5305 (2009)
Luca Bosa et al.
Scientific reports, 11(1), 5945-5945 (2021-03-17)
CARMIL2 is required for CD28-mediated co-stimulation of NF-κB signaling in T cells and its deficiency has been associated with primary immunodeficiency and, recently, very early onset inflammatory bowel disease (IBD). Here we describe the identification of novel biallelic CARMIL2 variants
T Schober et al.
Nature communications, 8, 14209-14209 (2017-01-24)
Human T-cell function is dependent on T-cell antigen receptor (TCR) and co-signalling as evidenced by immunodeficiencies affecting TCR-dependent signalling pathways. Here, we show four human patients with EBV+ disseminated smooth muscle tumours that carry two homozygous loss-of-function mutations in the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service