Skip to Content
Merck
CN
All Photos(8)

Documents

Safety Information

HPA039548

Sigma-Aldrich

Anti-BLMH antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Bh, Anti-Bleomycin hydrolase

Sign Into View Organizational & Contract Pricing
All Photos(8)

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA039548
NACRES:
NA.43

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human, rat, mouse

enhanced validation

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:5000-1:10000

immunogen sequence

RKEPEDGRLVQFLLMNPANDGGQWDMLVNIVEKYGVIPKKCFPESYTTEATRRMNDILNHKMREFCIRLRNLVHSGATKGEISATQDVMMEEIFRVVCICLGNP

UniProt accession no.

Q13867

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BLMH(642)

Related Categories

General description

Bleomycin hydrolase (BLMH) is an enzyme that is excreted by the kidneys. It is a neutral cysteine protease expressed at high levels in the skin. BLMH gene is mapped to human chromosome 17q11.2.

Immunogen

bleomycin hydrolase recombinant protein epitope signature tag (PrEST)

Application

Anti-BLMH antibody has been used in western blotting.

Biochem/physiol Actions

Bleomycin hydrolase (BLMH) has the ability to inactivate bleomycin. It is involved in Hcy (homocysteine) metabolism and is also associated with Alzheimer′s disease (AD). BLMH also participates in bleomycin resistance.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST75558

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Bleomycin hydrolase downregulation in lesional skin of adult atopic dermatitis patients is independent of FLG gene mutations.
Pellerin L, et al.
The Journal of Allergy and Clinical Immunology, 134(6), 1459-1461 (2014)
NF1 microdeletion syndrome: refined FISH characterization of sporadic and familial deletions with locus-specific probes.
Riva P, et al.
American Journal of Human Genetics, 66(1), 100-109 (2000)
Hyperhomocysteinemia and bleomycin hydrolase modulate the expression of mouse brain proteins involved in neurodegeneration.
Suszynska-Zajczyk J, et al.
Journal of Alzheimer'S Disease, 40(3), 713-726 (2014)
Effect of bleomycin hydrolase gene polymorphism on late pulmonary complications of treatment for Hodgkin lymphoma.
Jona A, et al.
PLoS ONE, 11(6), e0157651-e0157651 (2016)
Bleomycin hydrolase downregulation in lesional skin of adult atopic dermatitis patients is independent of FLG gene mutations.
Laurence Pellerin et al.
The Journal of allergy and clinical immunology, 134(6), 1459-1461 (2014-09-23)
View All Related Papers

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service