HPA030088
Anti-LMX1A antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab2
Synonym(s):
Anti-LIM homeobox transcription factor 1, α, Anti-LMX1, Anti-LMX1.1
Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
UNSPSC Code:
12352203
Human Protein Atlas Number:
storage temp.
−20°C
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunogen sequence
QRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLT
UniProt accession no.
shipped in
wet ice
Gene Information
human ... LMX1A(4009)
General description
The gene LMX1A (LIM homeobox transcription factor 1 α) is mapped to human chromosome 1q23.3. It is a paralogue of Lhx (LIM homeobox family) proteins.
Immunogen
LIM homeobox transcription factor 1, α recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
LMX1A (LIM homeobox transcription factor 1 α) is a transcription factor which is required for the development of dopaminergic neurons. It plays an important role in the dopaminergic pathway and is associated with schizophrenia and altered cognitive functioning. Mutation in the gene is also associated with risk of Parkinson′s disease. LMX1A gene is upregulated in advanced stages of pancreatic ductal adenocarcinoma. It is hypermethylated in squamous cell carcinoma and is a suppressor of metastasis in cervical cancer.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Other Notes
Corresponding Antigen APREST77007.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Cell fate determination, neuronal maintenance and disease state: The emerging role of transcription factors Lmx1a and Lmx1b.
Doucet-Beaupre H
Febs Letters, 589, 3727-3738 (2015)
Polymorphisms of dopamine pathway genes NRG1 and LMX1A are associated with cognitive performance in bipolar disorder.
Rolstad S, et al.
Bipolar Disorders, 17, 859-868 (2015)
High-resolution genomic copy number profiling of primary intraocular lymphoma by single nucleotide polymorphism microarrays.
Wang L, et al.
Cancer Science, 105, 592-599 (2014)
The correlations of LMX1A and osteopontin expression to the clinicopathologic stages in pancreatic adenocarcinoma.
Tsai WC, et al.
Applied Immunohistochemistry & Molecular Morphology, 21, 395-400 (2013)
Francesca Sgualdino et al.
Methods in molecular biology (Clifton, N.J.), 2764, 225-245 (2024-02-23)
Organoids are a powerful model system to explore the role of mechanical forces in sculpting emergent tissue cytoarchitecture. The modulation of the mechanical microenvironment is most readily performed using synthetic extracellular matrices (ECM); however, such materials provide passive, rather than
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service