Skip to Content
Merck
CN

HPA026776

Anti-GCNT2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-I-branching enzyme, Anti-IGNT, Anti-N-acetylglucosaminyltransferase, Anti-N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Anti-GCNT2 antibody produced in rabbit, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

EVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTREFVDFVLRDQRAIDLLQWSKDT

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... GCNT2(2651)

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

Glucosaminyl (N-acetyl) transferase 2 (GCNT2) is an enzyme essential for the development of the blood group I antigen. Biallelic mutation of GCNT2 leads to autosomal recessive congenital cataracts and the rare adult i blood group. GCNT2 associates with β1,3-N-acetylglucosminyltransferase 2(β3GnT2) to regulate the PLN levels in olfactory neurons by modulating β1, 6-branches that aids in Poly-N-acetyllactosamine (PLN) extension. Over human developmental stage, GCNT2 enzyme transforms linear i-antigen to I-branching glycan by replacing GlcNAc of uridine diphosphate–GlcNAc with galactose β1-6 linkage of linear lactosamine chains. Uprooted expression of GCNT2 enzyme increases cell detachment, cell adhesion, cell migration and invasion in vitro, and lung metastasis of breast cancer cells in vivo. Overexpression of GCNT2 contributes to breast cancer metastasis. Transforming growth factor-β1 (TGF-β1) acts as an effector of GCNT2 enzyme and plays a major role in TGF-β1induced epithelial-to-mesenchymal transition (EMT).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

General description

Glucosaminyl (N-acetyl) transferase 2 (GCNT2) protein is encoded by the novel metastasis-related gene mapped to human chromosome 6p24. The GCNT2 protein belongs to the β-1, 6-N-acetylglucosaminyltransferase family, which has an essential role in glycosylation.

Immunogen

N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST71799

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jotaro Mikami et al.
Cancer science, 107(3), 359-368 (2015-12-19)
Cell surface carbohydrates are important for cell migration and invasion of prostate cancer (PCa). Accordingly, the I-branching N-acetylglucosaminyltransferase (GCNT2) converts linear i-antigen to I-branching glycan, and its expression is associated with breast cancer progression. In the present study, we identified
I-branching N-acetylglucosaminyltransferase regulates prostate cancer invasiveness by enhancing a5?1 integrin signaling.
Mikami J
Cancer Science, 107(3), 359-368 (2016)
Engagement of I-branching {beta}-1, 6-N-acetylglucosaminyltransferase 2 in breast cancer metastasis and TGF-{beta} signaling.
Zhang Hs
Cancer Research, 71(14), 4846-4856 (2011)
Chia-Chun Chao et al.
FEBS letters, 591(13), 1902-1917 (2017-05-26)
β-1,6-N-acetylglucosaminyltransferase 2 (GCNT2), which encodes a key glycosyltransferase for blood group I antigen synthesis, is induced upon epithelial-mesenchymal transition (EMT). Our results indicate that GCNT2 is upregulated upon EMT induced with epidermal growth factor and basic FGF in cultured human
N-linked polylactosamine glycan synthesis is regulated by co-expression of ?3GnT2 and GCNT2.
Henion TR
Journal of Cellular Physiology, 229(4), 471-478 (2014)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service