Skip to Content
Merck
CN
All Photos(5)

Documents

Safety Information

HPA025244

Sigma-Aldrich

Anti-TSPOAP1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

Sign Into View Organizational & Contract Pricing
All Photos(5)
Synonym(s):
Anti-BZRAP1, Anti-KIAA0612, Anti-PRAX-1, Anti-RIM-BP1, Anti-RIMBP1, Anti-PBR-IP, Anti-Peripheral benzodiazepine receptor-interacting protein, Anti-Peripheral-type benzodiazepine receptor-associated protein 1, Anti-RIMS-binding protein 1
UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA025244
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

RTASTSTLGEKDPGPAAPSLAKQEAEWTAGEACPASSSTQGARAQQAPNTEMCQGGDPGSGLRPRAEKEDTAELGVHLVNSLVDHGRNSDLSD

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BZRAP1(9256)

General description

The gene BZRAP1 (benzodiazepine receptor (peripheral) associated protein 1) is mapped to human chromosome 17q22-q23. The mRNA is mainly expressed in the central nervous system, pituitary gland and thymus. The protein is mainly expressed in the brain and thymus. The protein is present in the cytoplasm and mitochondria, and has three proline-rich domains, three leucine-zipper motifs and an Src homology region 3-like domain.

Immunogen

TSPO associated protein 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

BZRAP1 (benzodiazepine receptor associated protein 1, also referred to as RIM-BP1 (RIMS-binding protein 1)) interacts with peripheral benzodiazepine receptor (PBR). It also interacts with the presynaptic active zone proteins RIMs (Rab-3 interacting molecules) and voltage-gated Ca2+-channels. RIM-BPs help in maintaining a functional connection between Ca2+-channels and the synaptic-vesicle tethering apparatus.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST75568

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

S Galiègue et al.
The Journal of biological chemistry, 274(5), 2938-2952 (1999-01-23)
Using a cytoplasmic domain of the peripheral benzodiazepine receptor (PBR) as a bait in the yeast two-hybrid system, we have isolated a cDNA encoding a new protein that specifically interacts with PBR. We named it PRAX-1, for peripheral benzodiazepine receptor-associated
Y Wang et al.
The Journal of biological chemistry, 275(26), 20033-20044 (2000-04-05)
RIM1 is a putative effector protein for Rab3s, synaptic GTP-binding proteins. RIM1 is localized close to the active zone at the synapse, where it interacts in a GTP-dependent manner with Rab3 located on synaptic vesicles. We now describe a second
Tobias Mittelstaedt et al.
Gene, 403(1-2), 70-79 (2007-09-15)
RIM-binding proteins (RIM-BPs) were identified as binding partners of the presynaptic active zone proteins RIMs as well as for voltage-gated Ca(2+)-channels. They were suggested to form a functional link between the synaptic-vesicle fusion apparatus and Ca(2+)-channels. Here we show that

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service