HPA023881
Anti-TFE3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Tfe3 Antibody, Tfe3 Antibody - Anti-TFE3 antibody produced in rabbit, TFEA, bHLHe33
Sign Into View Organizational & Contract Pricing
All Photos(8)
About This Item
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, rat, mouse
enhanced validation
RNAi knockdown
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
western blot: 0.04-0.4 μg/mL
UniProt accession no.
application(s)
research pathology
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... TFE3(7030)
General description
Transcription factor binding to IGHM enhancer 3 or transcription factor E3 (TFE3) gene is mapped to human chromosome Xp11.23. TFE3 belongs to helix-loop-helix leucine zipper family of transcription factors.
Immunogen
Transcription factor binding to ighm enhancer 3 recombinant protein epitope signature tag (PrEST).
Sequence
SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS
Sequence
SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS
Application
Anti-TFE3(Transcription factor binding to IGHM enhancer 3) antibody produced in rabbit has been used:
- in immunofluorescence
- in immunocytochemistry studies
- in immunostaining
Biochem/physiol Actions
Transcription factor binding to IGHM enhancer 3 (TFE3) interacts with other transcription factors and plays a key role in cell growth and proliferation. It promotes renal adenocarcinoma progression. TFE3 gene locus is also involved in translocations events resulting in a TFE3 fusion protein, which is a potential marker for screening their prevalence in renal cell carcinomas. It interacts and regulates expression of G-protein Gα16 and favors regulation of claudin 14.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST74277
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
WGK
WGK 1
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Epithelioid hemangioendotheliomas with TFE3 gene translocations are compossible with CAMTA1 gene rearrangements
Lee SJ, et al.
Testing, 7(7), 7480-7480 (2016)
TFE3 regulates renal adenocarcinoma cell proliferation via activation of the mTOR pathway
Fang Y, et al.
Molecular Medicine Reports, 16(3), 2721-2725 (2017)
Identification of Transcription Factor E3 (TFE3) as a Receptor-independent Activator of G alpha 16 GENE REGULATION BY NUCLEAR G alpha SUBUNIT AND ITS ACTIVATOR
Sato M, et al.
The Journal of Biological Chemistry, 286(20), 17766-17776 (2011)
ERK-independent African Green monkey pluripotent stem cells in a putative chimera-competent state
De Los Angeles A, et al.
Biochemical and Biophysical Research Communications, 510(1), 78-84 (2019)
Folliculin Regulates Osteoclastogenesis Through Metabolic Regulation
Baba M, et al.
Journal of Bone and Mineral Research, 33(10), 1785-1798 (2018)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service