HPA023030
Anti-SLFN11 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-Schlafen family member 11
Sign Into View Organizational & Contract Pricing
All Photos(8)
About This Item
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
immunogen sequence
REVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQPQRPITFTLKIVDVLKRGELYGYACMIRVNPFCCAVFSEAPNSWI
UniProt accession no.
application(s)
research pathology
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SLFN11(91607)
Related Categories
General description
SLFN proteins are found exclusively in mammals.
SLFN11 (schlafen family member 11) protein contains a putative AAA (ATPases associated with diverse cellular activities) domain. The gene is mapped to human chromosome 17q12.
Immunogen
Schlafen family member 11 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-SLFN11 antibody produced in rabbit has been used for immunohistochemistry study.
Anti-SLFN11 antibody produced in rabbit has been used for immunohistochemistry study.
Biochem/physiol Actions
SLFN proteins play a vital role in regulation of various biological functions such as cell-cycle arrest, differentiation, and cancer cell invasion. SLFN11 also acts as a dominant response factor of cancer cells to topoisomerase I inhibitors.
Schlafen (SLFN) genes are part of interferon-stimulated early response genes and are activated in the presence of pathogens by IRF3 (interferon regulatory factor 3) pathway. SLFN11 inhibits the generation of retroviruses, including human immunodeficiency virus 1 (HIV-1). It stops the production of viral proteins via codon-bias discrimination method. It also makes cancer cells sensitive to DNA-damaging agents.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST75872
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
PARP Inhibitor Activity Correlates with SLFN11 Expression and Demonstrates Synergy with Temozolomide in Small Cell Lung Cancer.
Lok BH, et al.
Clinical Cancer Research, 23, 523-535 (2017)
Genetic variation in schlafen genes in a patient with a recapitulation of the murine Elektra phenotype.
Mike Recher et al.
The Journal of allergy and clinical immunology, 133(5), 1462-1465 (2014-01-01)
Lauren Averett Byers et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 27(14), 3884-3895 (2021-05-06)
This study investigated the efficacy and safety of oral PARP inhibitor veliparib, plus carboplatin and etoposide in patients with treatment-naïve, extensive-stage small cell lung cancer (ED-SCLC). Patients were randomized 1:1:1 to veliparib [240 mg twice daily (BID) for 14 days]
Jessica Gartrell et al.
Molecular cancer therapeutics, 20(11), 2151-2165 (2021-08-21)
Pediatric sarcomas represent a heterogeneous group of malignancies that exhibit variable response to DNA-damaging chemotherapy. Schlafen family member 11 protein (SLFN11) increases sensitivity to replicative stress and has been implicated as a potential biomarker to predict sensitivity to DNA-damaging agents
SLFN11 is a transcriptional target of EWS-FLI1 and a determinant of drug response in Ewing sarcoma
Tang SW, et al.
Clinical Cancer Research, 21(18), 4184-4193 (2015)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service