Skip to Content
Merck
CN

HPA018433

Anti-CBR1 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-15-Hydroxyprostaglandin dehydrogenase [NADP+], Anti-Carbonyl reductase [NADPH] 1, Anti-NADPH-dependent carbonyl reductase 1, Anti-Prostaglandin 9-ketoreductase, Anti-Prostaglandin-E(2) 9-reductase

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.43
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
8
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Quality Level

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200

immunogen sequence

TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CBR1(873)

Looking for similar products? Visit Product Comparison Guide

General description

The gene CBR1 (carbonyl reductase [NADPH] 1) is mapped to human chromosome 21q22.13. CBR1 is a ubiquitously-expressed protein. The protein localizes in the cytoplasm and is monomeric in nature. CBR1 is abundantly present in amnion epithelial, fibroblast cells and chorionic trophoblast cells.

Immunogen

Carbonyl reductase [NADPH] 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Carbonyl reductase [NADPH] 1 (CBR1) is an NADPH-dependent dehydrogenase/reductase and is responsible for the in vivo reduction of quinones, prostaglandins and other carbonyl-containing compounds including xenobiotics. In addition nitrogen-containing GSH adduct S-nitrosoglutathione (GSNO) is an efficient substrate of CBR1. CBR1 activity can be inhibited by various flavonoids including quercetin, rutin and semi-synthetic flavonoid monoHER (7-monohydroxyethylrutoside). Curcumin, a major component of the plant Curcuma longa, is a potent tight-binding inhibitor of CBR1. Absence of CBR1 promotes ovarian cancer growth and proliferation. CBR1 is responsible for conversion of cytotoxic daunorubicin to cardiotoxic daunorubicinol, thus reducing cytotoxicity of daunorubicin in primary acute myeloid leukemia cells. Glucocorticoid receptor binding to the CBR1 promoter stimulates CBR1 production in in human amnion fibroblasts. Presence of CBR1 converts prostaglandin E2 to prostaglandin F2α, which is involved in induction of human labor. NRF2 (Nuclear factor erythroid 2-related factor 2) is a transcriptional regulator of CBR1.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73872

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Savitha Varatharajan et al.
European journal of clinical pharmacology, 68(12), 1577-1586 (2012-05-09)
The present study aimed to investigate the role of expression of daunorubicin-metabolizing enzymes carbonyl reductase 1 and 3 (CBR1 and CBR3) on the in vitro cytotoxicity of daunorubicin in primary acute myeloid leukemia (AML) cells and the effect of genetic
Raynard L Bateman et al.
The Journal of biological chemistry, 283(51), 35756-35762 (2008-10-02)
Human carbonyl reductase 1 (hCBR1) is an NADPH-dependent short chain dehydrogenase/reductase with broad substrate specificity and is thought to be responsible for the in vivo reduction of quinones, prostaglandins, and other carbonyl-containing compounds including xenobiotics. In addition, hCBR1 possesses a
Javier G Blanco et al.
Cancer, 112(12), 2789-2795 (2008-05-07)
Exposure to anthracyclines as part of cancer therapy has been associated with the development of congestive heart failure (CHF). The potential role of genetic risk factors in anthracycline-related CHF remains to be defined. Thus, in this study, the authors examined
Takeshi Miura et al.
Chemico-biological interactions, 202(1-3), 126-135 (2012-12-19)
Monomeric carbonyl reductase 1 (CBR1, SDR21C1) is a member of the short-chain dehydrogenase/reductase superfamily and is involved in the metabolism of anthracycline anti-cancer drugs, prostaglandins, and isatin, which is an endogenous inhibitor of monoamine oxidases. Additionally, cancer progression may be
Yuki Osawa et al.
International journal of oncology, 46(3), 1252-1258 (2015-01-13)
Carbonyl reductase 1 (CBR1) expression level is related to tumor progression. Decreased CBR1 expression is associated with poor prognosis in ovarian cancer. We investigated the relationship between CBR1 expression level and malignant potential of ovarian cancer. OVCAR‑3 cells overexpressing CBR1

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service