Skip to Content
Merck
CN

HPA018139

Anti-GOT2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Aspartate aminotransferase, mitochondrial precursor, Anti-FABP-1, Anti-FABPpm, Anti-Fatty acid-binding protein, Anti-Glutamate oxaloacetate transaminase 2, Anti-Transaminase A, Anti-mAspAT

Sign In to View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, rat, human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

GFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVER

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GOT2(2806)

General description

The gene glutamate oxaloacetate transaminase-2 (GOT2) is located in human chromosome 16 (16q21). The protein is an aspartate aminotransfaerase (AST) enzyme. Two distinct forms of AST have been identified: a cytoplasmic (GOT1) and a mitochondrial isoform (GOT2). GOT2 has been identified within mitochondria and on the plasma membrane in HepG2 cells.

Immunogen

Aspartate aminotransferase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-GOT2 antibody produced in rabbit has been used in western blotting and immunohistochemistry.

Biochem/physiol Actions

The protein Glutamate oxaloacetate transaminase-2 (GOT2) participates in amino acid metabolism, converting aspartate and α-ketoglutarate (aKG) to oxaloacetate (OAC) and glutamate. GOT2 also provides a major route for reducing equivalents into mitochondria through its participation in the malate:asparte shuttle. GOT2K159 acetylation increases in human pancreatic tumors. It is shown to be involved in growth of human pancreatic adenocarcinoma. Long term ethanol exposure up-regulates GOT2 levels in the plasma membrane of HepG2 cells. The protein level increases in type2 diabetes patients post exercise training. Using mass spectroscopy and nuclear magnetic resonance approach decreased level of the enzyme was observed in brains from schizophrenia-induced rats and post-mortem schizophrenia patients. Proteomic analysis of Vastus lateralis muscle in mature and older women showed down-regulation of the protein in older women, indicating its involvement in muscle aging.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73325

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品
常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Sophie E Hussey et al.
Medicine and science in sports and exercise, 45(6), 1069-1076 (2013-01-01)
Exercise training alters protein abundance in the muscle of healthy individuals, but the effect of exercise on these proteins in patients with type 2 diabetes (T2D) is unknown. The aim of this study was to determine how exercise training alters
HIF1 alpha suppresses tumor cell proliferation through inhibition of aspartate biosynthesis
Melendez R F, et al.
Testing, 26(9), 2257-2265 (2019)
Laëtitia Théron et al.
Molecular & cellular proteomics : MCP, 13(1), 283-294 (2013-11-13)
Sarcopenia corresponds to the loss of muscle mass occurring during aging, and is associated with a loss of muscle functionality. Proteomic links the muscle functional changes with protein expression pattern. To better understand the mechanisms involved in muscle aging, we
Hendrik Wesseling et al.
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology, 38(12), 2532-2544 (2013-08-15)
Current schizophrenia (SCZ) treatments fail to treat the broad range of manifestations associated with this devastating disorder. Thus, new translational models that reproduce the core pathological features are urgently needed to facilitate novel drug discovery efforts. Here, we report findings
Silvia Sookoian et al.
World journal of gastroenterology, 21(3), 711-725 (2015-01-28)
For several decades, serum levels of alanine (ALT) and aspartate (AST) aminotransferases have been regarded as markers of liver injury, including a wide range of etiologies from viral hepatitis to fatty liver. The increasing worldwide prevalence of metabolic syndrome and

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service