Skip to Content
Merck
CN
All Photos(3)

Key Documents

Safety Information

HPA015066

Sigma-Aldrich

Anti-CYP2C9 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CYP2C10, Anti-P450IIC9

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

KEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTST

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CYP2C9(1559)

General description

CYP2C19 (cytochrome P450, family 2, subfamily C, polypeptide 19) is a member of the cytochrome P450 enzyme family. It is an essential enzyme of phase I metabolism, and is highly expressed in smooth muscle and endothelial cells. This gene is localized to human chromosome 10, and the encoded protein is composed of 490 amino acids.

Immunogen

cytochrome P450, family 2, subfamily C, polypeptide 9

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-CYP2C9 antibody produced in rabbit has been used in immunohistochemistry (1:200).

Biochem/physiol Actions

CYP2C19 (cytochrome P450, family 2, subfamily C, polypeptide 19) is a part of the metabolism of xenobiotics and therapeutic drugs such as, omeprazole, S-mephenytoin, propranolol, diazepam, proguanil, and particular antidepressants. It also inactivates and detoxifies certain carcinogens, and also produces DNA-binding reactive metabolites from environmental procarcinogens. This functionality of CYP2C19 is determined by variants in this gene. Thus, this gene is linked to susceptibility to developing cancer. In Chinese population, CYP2C19*2 polymosphism in this gene is associated with esophageal squamous cell carcinoma. CYP2C19*2 variant is also linked to decreased clearance of proton pump inhibitors such as, omeprazole, pantoprazole and rabeprazole, which results in higher efficacy of these drugs. It is also involved in the catabolism of estrogen, and thus, it affects the molecular subtype of breast cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73009

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

新产品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Xian-E Peng et al.
BMC medical genetics, 16, 15-15 (2015-05-01)
The purpose of this study was to explore the effects of CYP2C19 gene polymorphisms and various environmental factors and their interactions on the risk of esophageal squamous cell carcinoma (ESCC) in a Chinese Han population. A 1:2 frequency-matched case control
Ryo Ashida et al.
Oncotarget, 9(31), 22058-22068 (2018-05-19)
Project HOPE (High-tech Omics-based Patient Evaluation) began in 2014 using integrated gene expression profiling (GEP) of cancer tissues as well as diathesis of each patient who underwent an operation at our institution. The aim of this study was to clarify
Anna Tervasmäki et al.
BMC cancer, 14, 902-902 (2014-12-04)
Using a genome-wide approach, we have previously observed an increase in the frequency of rare copy number variants (CNVs) in familial and early-onset breast cancer cases when compared to controls. Moreover, the biological networks of the CNV disrupted genes differed
Manuel Román et al.
Pharmacogenomics, 15(15), 1893-1901 (2014-12-17)
To evaluate the possible association between polymorphisms in CYP2C19 and the pharmacokinetics of omeprazole, rabeprazole and pantoprazole. 151 healthy volunteers were evaluated for polymorphisms in the CYP2C19 gene using real-time polymerase chain reaction. Plasma concentrations were measured using high-performance liquid
Jing-Fang Wang et al.
Biochemical and biophysical research communications, 355(2), 513-519 (2007-02-20)
Cytochrome P450 2C19 (CYP2C19) is a member of the cytochrome P-450 enzyme superfamily and plays an important role in the metabolism of drugs. In order to gain insights for developing personalized drugs, the 3D (dimensional) structure of CYP2C19 has been

Articles

Phase I biotransformation reactions increase drug compound polarity, mainly occurring in hepatic circulation.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service