Skip to Content
Merck
CN
All Photos(1)

Key Documents

Safety Information

HPA012571

Sigma-Aldrich

Anti-TREM2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-TREM-2 antibody produced in rabbit, Anti-Triggering receptor expressed on monocytes 2 antibody produced in rabbit, Anti-Triggering receptor expressed on myeloid cells 2 precursor antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 1-4 μg/mL

immunogen sequence

QVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFP

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... TREM2(54209)

Looking for similar products? Visit Product Comparison Guide

General description

TREM2 (triggering receptor expressed on myeloid cells 2) is a transmembrane receptor belonging to the immunoglobulin (Ig) family. It is composed of an extracellular region containing the Ig-like domain and a cytoplasmic tail. It has a transmembrane region of 33 amino acids followed by a cytoplasmic tail. It is expressed on myeloid cells such as, macrophages found in tissue and dendritic cells, on microglial cells in the brain.

Immunogen

Triggering receptor expressed on myeloid cells 2 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

TREM2 (triggering receptor expressed on myeloid cells 2) is involved in bacterial phagocytosis and regulation of inflammatory response. Its presence in microglia helps to remove the neural debris i.e. amyloid β peptide (Aβ) on microglia. TREM2 suppresses the ability of microglia to phagocytize Aβ, and disturbs the pro-inflammatory activity of these cells. Parkinson′s disease (PD) is portrayed by the degeneration of dopaminergic neurons, in the substantia nigra standards compacta district of the cerebrum. TREM2 binds specifically to the ligands expressed by these dopaminergic neurons. Likewise, microgliosis is additionally involved in the progress of PD. Hence, TREM2 gene might be linked to susceptibility to PD. p.R47H polymorphism in this gene is identified with increased risk of sporadic amyotrophic sidelong sclerosis. Mutation in TREM2 is also associated with polycystic lipomembranous osteodysplaysia with sclerosing leukoencephalop.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71704.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Shane P Duggan et al.
Cellular and molecular gastroenterology and hepatology, 5(4), 569-590 (2018-06-23)
Effective therapeutic approaches are urgently required to tackle the alarmingly poor survival outcomes in esophageal adenocarcinoma (EAC) patients. EAC originates from within the intestinal-type metaplasia, Barrett's esophagus, a condition arising on a background of gastroesophageal reflux disease and associated inflammation. This study
A survey of TREM2 antibodies reveals neuronal but not microglial staining in formalin-fixed paraffin-embedded postmortem Alzheimer's brain tissues.
Jun-Ichi Satoh et al.
Alzheimer's research & therapy, 5(4), 30-30 (2013-07-09)
Isabelle Le Ber et al.
Neurobiology of aging, 35(10), 2419-2419 (2014-06-10)
TREM2 mutations were first identified in Nasu-Hakola disease, a rare autosomal recessive disease characterized by recurrent fractures because of bone cysts and presenile dementia. Recently, homozygous and compound heterozygous TREM2 mutations were identified in rare families with frontotemporal lobar degeneration
Janet Cady et al.
JAMA neurology, 71(4), 449-453 (2014-02-19)
Amyotrophic lateral sclerosis (ALS) is a fatal neurodegenerative disease in which microglia play a significant and active role. Recently, a rare missense variant (p.R47H) in the microglial activating gene TREM2 was found to increase the risk of several neurodegenerative diseases
Zainularifeen Abduljaleel et al.
PloS one, 9(3), e92648-e92648 (2014-03-26)
Alzheimer's disease is one of the main causes of dementia among elderly individuals and leads to the neurodegeneration of different areas of the brain, resulting in memory impairments and loss of cognitive functions. Recently, a rare variant that is associated

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service