Skip to Content
Merck
CN
All Photos(4)

Documents

Safety Information

HPA010948

Sigma-Aldrich

Anti-DPYSL3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CRMP-4, Anti-Collapsin response mediator protein 4, Anti-DRP-3, Anti-Dihydropyrimidinase-related protein 3, Anti-ULIP protein, Anti-Unc-33-like phosphoprotein

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human, rat, mouse

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500

immunogen sequence

IIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DPYSL3(1809)

General description

DPYSL3 (dihydropyrimidinase-like 3) belongs to collapsin response mediator proteins (CRMPs) family, which are phosphoproteins that reside in the cytoplasm. In humans, this family consists of five members. DPYSL3 has two isoforms due to alternate splicing. The long isoform consists of an extra domain in the N-terminal, the function and structure of which is not known. This family of proteins is highly expressed in the nervous system during developmental stages. This gene is localized to human chromosome 5q32. DPYSL3 is not found in adult brain, but is expressed in brain and spinal cord of fetus.

Immunogen

Dihydropyrimidinase-related protein 3 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

DPYSL3 (dihydropyrimidinase-like 3) aids semaphorin/collapsin to induce collapse of the growth cone, regulates the differentiation of neurons and aids in axon guidance. It also plays an essential role in the development of the human nervous system. Its expression is induced in a certain subset of nervous system tumors and might act as an oncofetal neural antigen. This protein aids in the alignment of chromosomes by facilitating the bundling of F-actin, and therefore, mediates microtubule dynamics in mitosis. DPYSL3 suppresses metastasis in prostate cancer but facilitates the same in lung cancer. It is also linked with poor prognosis in neuroblastoma and pancreatic cancer. Polymorphism in this gene is also implicated in amyotrophic lateral sclerosis (ALS) in French population. In ischaemic stroke, it plays a role as a therapeutic target. DPYSL3 is involved in the tumorigenesis of pancreatic ductal adenocarcinoma, and has potential as a marker and therapeutic target for the same.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70138

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Takeo Kawahara et al.
PloS one, 8(12), e79654-e79654 (2013-12-18)
Elucidation of how pancreatic cancer cells give rise to distant metastasis is urgently needed in order to provide not only a better understanding of the underlying molecular mechanisms, but also to identify novel targets for greatly improved molecular diagnosis and
Rajesh Ponnusamy et al.
Acta crystallographica. Section D, Biological crystallography, 70(Pt 6), 1680-1694 (2014-06-11)
Collapsin response mediator proteins (CRMPs) are cytosolic phosphoproteins that are mainly involved in neuronal cell development. In humans, the CRMP family comprises five members. Here, crystal structures of human CRMP-4 in a truncated and a full-length version are presented. The
Yoon-La Choi et al.
Journal of neuro-oncology, 73(1), 19-27 (2005-06-04)
HUlip is a human homologue of a C. elegans gene, unc-33, that is developmentally regulated during maturation of the nervous system. HUlip is highly expressed only in the fetal brain and spinal cord, and is undetected in the adult brain.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service