Skip to Content
Merck
CN

HPA010921

Anti-CARD19 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-BinCARD, Anti-C9orf89, Anti-MGC11115, Anti-bA370F5.1

Sign In to View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

PKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLG

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... C9orf89(84270)

General description

C9orf89 (chromosome 9 open reading frame 89) is also known as BinCARD (Bcl10-interacting protein with CARD). It belongs to the superfamily of death-domain proteins. This protein has two isoforms which differ in their C-termini, but have the same caspase recruitment domain (CARD) in the N-termini. C9orf89 is expressed ubiquitously.

Immunogen

caspase recruitment domain family, member 19

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

C9orf89 (chromosome 9 open reading frame 89) interacts with Bcl10, through its CARD (caspase recruitment domain) domain. It reduces the amount of phosphorylated Bcl10, and inhibits the activation of NF-κB by Bcl10. The other isoform of C9orf89, called BinCARD-2 resides in mitochondria and is suggested to have a regulatory role in the mitochondrial redox signaling.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST72158

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Ha-Na Woo et al.
FEBS letters, 578(3), 239-244 (2005-01-11)
We have identified a novel CARD-containing protein from EST database. BinCARD (Bcl10-interacting protein with CARD). BinCARD was ubiquitously expressed. Co-immunoprecipitation, In vitro binding, mammalian two-hybrid, and immunostaining assays revealed that BinCARD interacted with Bcl10 through CARD. BinCARD potently suppressed NF-kappa
Tomoaki Saito et al.
International journal of molecular sciences, 23(16) (2022-08-27)
Advanced-stage oral squamous cell carcinoma (OSCC) patients are treated with combination therapies, such as surgery, radiation, chemotherapy, and immunotherapy. However, OSCC cells acquire resistance to these treatments, resulting in local recurrence and distant metastasis. The identification of genes involved in
Kai En Chen et al.
Acta crystallographica. Section D, Biological crystallography, 69(Pt 5), 774-784 (2013-05-02)
The caspase recruitment domain (CARD) is present in death-domain superfamily proteins involved in inflammation and apoptosis. BinCARD is named for its ability to interact with Bcl10 and inhibit downstream signalling. Human BinCARD is expressed as two isoforms that encode the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service